KEGG   Streptococcus sanguinis: SSA_1056Help
Entry
SSA_1056          CDS       T00473                                 

Definition
Firmicute fructose-1,6-bisphosphatase (EC:3.1.3.11)
Orthology
K04041  
fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
ssa  Streptococcus sanguinis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ssa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SSA_1056
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSA_1056
   00030 Pentose phosphate pathway
    SSA_1056
   00051 Fructose and mannose metabolism
    SSA_1056
  Energy metabolism
   00680 Methane metabolism
    SSA_1056
Enzymes [BR:ssa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     SSA_1056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1071900..1073810
Genome map
AA seq 636 aa AA seqDB search
MEQYKRILLKEFDSRQKVITELTNLEAILNLPKGTELYISDIHGEFAAFDYILRSCAGIL
NEKIKDCFGDSLSEVHKDRLSALVSYPELVLGEETKGQDWYQETIPQLLNLLAFAGAKYS
RSKVRKALPPQYAYIIEELLYSDTALADKKSYFENILTYVIELREAVPFILGLSRSIRQL
LIDHLHVVGDIFDRGVGSAQVIDELQHFHSLDIQWGNHDIIWMGAFFGSKACLLNVLRIA
ARYGYLWDIEKDYGLNLRSLTLFADKTYQSNPKFRPILGGREQEFSEEEILQLEKVHQAL
SIIQFKLENQLIKRRPEFQMQDHVMLDKIDYWEESITIDDTKHALVNTCFQTINPENPSA
LTPEENQAVDSMLASFQSSLKMAEHMSLLMNKGSMYKIYNKHLLFHGCIPLEPSGEFQPF
ILNQAHYAGKELLDFFEYHIRQAAKDKEVGDDLSTDLIWYCWKGKLSPLFGKEKMTTLER
YFIEDKETHKEVENSYFSYRNSEKVCQLILEEFGLFSQESRMVNGHTPVKTGKGESPIRG
GGLLFVIDGGLCKAYQKKTGTAGYSLLNNSYGFQLVTHQPFQNAQKVVESPFAQTSLKKV
IENVEERTLIKSTTIGQSLLAQQQELFGLLHEFYDR
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atggagcaatataagcgtattttattgaaagaatttgacagtcgccagaaagtcattaca
gaactgaccaacctagaggcaattttgaacctgcccaaagggacggagctgtatatcagt
gacattcacggggagtttgctgcatttgactatattttgagaagctgtgcaggtatcctc
aatgagaagatcaaggactgttttggggacagcttgtcagaagttcataaggaccggctc
tcagcgctggtttcctatcctgagcttgtgctgggggaagaaactaaaggccaagactgg
tatcaggaaaccattccccagctcttgaacttgctggcttttgcgggtgcaaaatacagt
cggtccaaggttagaaaggccttgccgccacagtatgcctatattatcgaggagttgctc
tatagtgacacggctctagctgataaaaagtcctattttgagaatatcctgacttatgtg
attgaattgcgggaagctgtgccttttatcctaggcttgtcccgaagtattcggcagttg
ttgattgaccatctgcatgtggttggagacatttttgacagaggagttggtagtgctcag
gtcattgatgaactgcagcattttcactcgctcgatattcagtggggcaatcacgacatt
atctggatgggagccttttttggctctaaggcctgcttgctcaatgtgttgcgcatcgca
gctcgctatggctatctctgggatatcgagaaagattatggtttaaacctgcgctctttg
accctttttgcggacaagacttaccagtctaatcctaagtttaggcctattcttggtggc
agagagcaggagttttctgaagaggaaattctgcaactggaaaaggttcaccaagccttg
tcgattatccagttcaagctggaaaatcaacttatcaaacgacggcctgaattccagatg
caggaccatgtcatgttggacaagattgactattgggaagaaagcattacgattgacgat
actaaacatgccctggttaatacctgcttccaaactatcaatccggaaaatccttcagct
ttgacaccagaagaaaatcaagctgtagacagtatgctggcctcgttccaaagttctctt
aagatggcagagcatatgagtcttctgatgaacaagggctctatgtataaaatctacaat
aagcacttgctttttcacggctgcattcctttggagccatcaggagaattccagcctttc
attctcaatcaagcccattatgcgggcaaggaattgctggatttctttgagtatcatatt
cggcaggcggccaaggacaaggaagtgggcgatgatttgtcgactgatttgatttggtat
tgctggaaaggtaagctatcgcccctgtttggcaaagaaaagatgactaccttggagcgc
tatttcattgaagataaggagacccacaaggaagtggaaaattcttatttttcttatcgt
aattctgagaaagtctgtcaactaatcttggaagaatttggcctcttttctcaagagtct
aggatggtcaatggtcatactccggttaagacgggcaagggagagtcgcctatccgtggg
ggcggtctgctctttgtcattgatggtggcctctgcaaggcctatcagaagaagactgga
acggctggctattcactgctcaataattcctatggcttccagttggtgacccatcagcct
ttccaaaacgctcaaaaagtcgttgaatcgccgtttgctcaaacctccctgaaaaaggtg
attgaaaatgtagaggaacgaaccctcatcaaatctactaccatcggtcagagcttgtta
gctcaacaacaggaactctttggcttattacatgagttttatgaccggtga

DBGET integrated database retrieval system