KEGG   Streptococcus sanguinis: SSA_1065Help
Entry
SSA_1065          CDS       T00473                                 

Definition
Beta-hexosamidase A (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ssa  Streptococcus sanguinis
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ssa00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SSA_1065
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    SSA_1065
Enzymes [BR:ssa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SSA_1065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1081398..1084190
Genome map
AA seq 930 aa AA seqDB search
MMKRYKLLLALALSLLVFWPLGAIKADSVNQPPESANQSEQASAAVVTDSSDSGAGARGT
PSQDSQIAAKALTVSDTSAVAGAETAASNQTANAENLVDNSAKPATAQAAEASSEANQAQ
GQAETDAPSASNRVQQLVADMTLRQKITQMLMPDFRKWQQEGQAAQFDMTELNKEVAEAV
DKYDFGGVILFAENVKGTAQTLALTQALQQAAISNQANNGKLPLLLAIDQEGGIVYRLGS
GTALPGNMAVGATRDPELANQAGQIIGRELSALGLNVNFAPVFDTNNNPQNPVIGLRSFS
SDPKVVARLGTAMMEGIQKYNVAVAAKHFPGHGDTAVDSHTGLPLVDKSYAELEALELLP
FKAAIDKNADMLMTAHIQYPQIEKDTVISKQTGETIYIPATLSDDIITGIVRKKFGYKGV
VVSDAMGMDAIAKNFGESEAAIMAIKSGVDVVLMPTVLRSKSDLAKIDKIINDIELAVQR
GDIPVSRLDESVTRILNLKEKRGILDFDPSERTQAKAEATVGSELNRDTERKIAASAVTV
VKNDNTVLPFKVKSGDRILMLAAYDDEVPGLELGVKRLIADGVIPAGVTYEALNYSKTTK
LEDLKGKIDQATHLVLISEIGRQSQLASDFWLTRVPTEVVDYANATGKQAAIMSISKPYD
VANYPNAKAIVAVYGNKGMDPTESLKPDNAFGPNIPAGVEVIFNGQNHVGKLPVNVPLIK
DGIMSETEVAYPIGHGLFYTDPVKDIKLNIPSSAQLDQPFTATVTLSGLNGLEKNDYRLA
LKVDSQHFSILPSPDYTISGDTVLISKKANDTNPVEINLKGLVEGQFSPVLSLTLIDSQD
REFSMGEGYYKELVQIAAAGQNTIPGQQTPSQLSLRSVEPVSSRRQLSQQAAQFNQLPKT
GDSSSLFLVLLGALFLFGAVYLYDLSSRRL
NT seq 2793 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaaggtataaattgctattggcgcttgccttatcattactagttttttggcca
ttgggagccataaaagcagattcggttaatcagccgccagaatctgctaaccagtctgaa
caagcaagtgctgcagttgtaacggactcttctgatagtggtgcaggggctaggggcaca
ccaagtcaggatagtcagattgctgcaaaagctctgacggtctctgatacttcggcagtt
gcaggtgctgagacggctgcttcaaaccaaactgccaatgcagaaaatttggtggataat
tctgccaaaccagcgactgctcaggctgcagaagcttcctcagaagctaatcaagctcaa
ggtcaggctgagactgatgcgccgtcggcttctaatagagtacagcagcttgtggcggat
atgacgcttcgtcagaagattacccagatgctgatgccagacttcagaaaatggcagcaa
gagggtcaagccgcccagttcgatatgacggagcttaataaagaagtggcagaagcggtt
gataaatacgactttggcggagttattctttttgctgagaatgtgaaagggactgctcaa
accttagccttgactcaagccctgcagcaagcagctatcagcaatcaagctaataatggt
aagttgccgctcttgcttgctatagaccaagaaggtggtattgtctatcgtttggggagc
gggactgctcttccaggcaatatggcagttggcgcgacgcgagatccagaattagccaat
caagcaggtcaaatcatcggacgggaactatcggctctaggtttgaatgtcaactttgcc
ccagtatttgatacaaataataatccgcagaatcccgttattggtttgcggtccttctct
tctgatcctaaggtggttgcccgtttgggaacggctatgatggaggggattcagaaatac
aatgttgcagtagcggctaagcatttccctgggcatggtgatacggcggtagattctcat
actggtctgcctctggtagataagtcctatgcagagttagaagcactggagttgcttcct
ttcaaggctgccattgacaaaaacgctgatatgctgatgactgcccatatccaatatcct
cagatcgaaaaagacacggttatatctaaacaaactggggaaaccatctatatccctgct
accttatctgatgacattattaccggtattgttcgtaagaaatttggctacaagggagtg
gtggtatctgatgctatgggcatggatgcgattgccaaaaactttggagaatccgaagcg
gctatcatggcaatcaaatcaggtgtagatgtggtgctgatgccaactgtcttacgcagc
aagagtgatttagctaaaatcgataagattatcaatgatattgagctggcggttcagaga
ggggatattccagtcagcagattggatgagtctgtgacccgcatcttgaacctaaaagaa
aaacgaggtattttagactttgacccatctgaacgtacccaagctaaggctgaagcaact
gttggctcagagttaaacagagatactgaacgaaaaatcgctgctagtgcagtgaccgta
gtaaaaaacgataatactgttctgccctttaaggttaaatctggcgacagaattttgatg
ctagcggcttatgacgatgaagtacctggactagagttgggtgtcaagcgtctgatagcg
gacggagtgattccagcaggtgtcacatacgaagcgctgaactacagcaaaacaaccaag
ttagaagatttgaaaggaaagattgaccaagcgacacaccttgtcttaatctctgaaatt
ggacgtcaatctcaactagccagcgatttctggctgacaagagttccgacagaagtcgtg
gactatgcaaacgcaactggaaaacaagcagctatcatgagcatttctaaaccttatgat
gtagcgaattatcctaatgccaaggctattgtagcagtttatggaaacaagggcatggat
ccaacagagtctctgaagcctgacaacgccttcggtcctaatatcccagcaggtgtggaa
gtcattttcaatggtcaaaatcatgttgggaagttaccggtaaatgtgccgctcatcaag
gatggtatcatgtctgagacagaggttgcctatcctatcgggcatggtctcttttatacc
gatccagttaaggatatcaaactcaatatcccttcatctgctcagctagatcagcctttt
acagctactgttaccctgagtggactaaatggtctagagaaaaatgattatcgtcttgct
cttaaggtggatagtcagcacttcagcatcctgccaagtcctgactataccatctctggt
gatactgttttgatttctaaaaaagccaatgatactaatccggttgagattaacttgaaa
ggcttagtagaaggtcagttcagtccagtgctttccctaaccttgattgacagtcaagac
agagaattcagcatgggagaaggttattacaaggagcttgttcagattgctgcagctggg
cagaacacgattccaggccaacaaactccttctcagttgagtttgcgttctgttgaacct
gtaagttctcgtcggcagctaagtcagcaggctgcacagtttaatcagcttccaaaaaca
ggagacagcagcagtttgttcttagtcttgctgggtgccttgttcttgtttggggctgtc
tatctgtatgacttgtcctctcgcagactataa

  All links  
No link information was found.   
DBGET integrated database retrieval system