KEGG   Streptococcus sanguinis: SSA_1090Help
Entry
SSA_1090          CDS       T00473                                 

Gene name
glcK
Definition
(RefSeq) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
ssa  Streptococcus sanguinis
Pathway
ssa00010  Glycolysis / Gluconeogenesis
ssa00052  Galactose metabolism
ssa00500  Starch and sucrose metabolism
ssa00520  Amino sugar and nucleotide sugar metabolism
ssa00521  Streptomycin biosynthesis
ssa01100  Metabolic pathways
ssa01110  Biosynthesis of secondary metabolites
ssa01120  Microbial metabolism in diverse environments
ssa01130  Biosynthesis of antibiotics
ssa01200  Carbon metabolism
Module
ssa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ssa_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ssa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSA_1090 (glcK)
   00052 Galactose metabolism
    SSA_1090 (glcK)
   00500 Starch and sucrose metabolism
    SSA_1090 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    SSA_1090 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SSA_1090 (glcK)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SSA_1090 (glcK)
Enzymes [BR:ssa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SSA_1090 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FGGY_N
Motif
Other DBs
NCBI-GeneID: 4808034
NCBI-ProteinID: YP_001035053
UniProt: A3CMU8
Position
1107711..1108670
Genome map
AA seq 319 aa AA seqDB search
MSKKIIGIDLGGTSIKFAILTSEGEIQEKWSIKTNILDEGSHIVEDMIESILHRLDLLQL
SAEDFIGIGMGSPGVVDREKGTVIGAYNLNWKTLQPVKDKIEKATGIPFYIDNDANVAAL
GERWMGAGENQPDVVFMTLGTGVGGGIVAEGKLLHGLAGAAGELGHITVDFDQPIQCTCG
KKGCLETVASATGIVNLTRRYADEYAGDAELKKLIDNGEDVNAKVVFDLAKEGDELALIV
YRNFARYLGIACANIGSILNPSTIVIGGGVSAAGDFLLDGVRKVYEENSFPQVRTSTKLA
LATLGNDAGVIGAASLVLQ
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaaaaaataatcggaattgaccttggtggaacatctattaagtttgctattttg
acttcagagggcgaaattcaagaaaaatggtccattaaaaccaatattttggacgaagga
agccacatcgtagaggatatgattgagtcaatcctgcatcgtttggacttgcttcagctt
tcagcagaggattttatcggaattggtatgggatcgccaggagttgttgaccgagaaaag
ggcactgttattggtgcttacaacctcaattggaagacgctgcagccagtcaaggataag
attgaaaaagcgactgggattcctttctatattgacaacgatgctaacgttgctgctttg
ggcgaacgctggatgggcgctggagaaaaccagcctgatgttgtcttcatgacactagga
acaggtgttggcggaggaatcgttgcagaaggcaagctcttgcacggacttgctggagca
gcaggagagttgggtcatatcactgttgacttcgatcagccgattcaatgtacctgtggc
aagaagggatgcttggagacggttgcatccgcgactggtattgtcaatctgactcgccgc
tatgctgatgagtatgctggtgatgctgagctgaaaaaactgattgacaacggtgaagat
gtcaatgcaaaagttgtctttgacttggcgaaagagggcgatgagctggctctgattgtc
tatcgcaatttcgctcgctatctaggtattgcctgtgccaatatcggctctatcctaaat
ccatctacaatcgttatcggaggtggcgtatcagctgcaggtgatttcttacttgatggc
gttcgcaaggtttatgaagagaatagcttcccgcaggttcgtacttcaaccaagttggcc
ttggctactcttggaaatgatgctggcgttatcggggcagcttcattggtattacaataa

DBGET integrated database retrieval system