KEGG   Streptococcus sanguinis: SSA_1090Help
Entry
SSA_1090          CDS       T00473                                 

Gene name
glcK
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ssa  Streptococcus sanguinis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ssa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SSA_1090 (glcK)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSA_1090 (glcK)
   00052 Galactose metabolism
    SSA_1090 (glcK)
   00500 Starch and sucrose metabolism
    SSA_1090 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    SSA_1090 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SSA_1090 (glcK)
   00524 Butirosin and neomycin biosynthesis
    SSA_1090 (glcK)
Enzymes [BR:ssa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SSA_1090 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1107711..1108670
Genome map
AA seq 319 aa AA seqDB search
MSKKIIGIDLGGTSIKFAILTSEGEIQEKWSIKTNILDEGSHIVEDMIESILHRLDLLQL
SAEDFIGIGMGSPGVVDREKGTVIGAYNLNWKTLQPVKDKIEKATGIPFYIDNDANVAAL
GERWMGAGENQPDVVFMTLGTGVGGGIVAEGKLLHGLAGAAGELGHITVDFDQPIQCTCG
KKGCLETVASATGIVNLTRRYADEYAGDAELKKLIDNGEDVNAKVVFDLAKEGDELALIV
YRNFARYLGIACANIGSILNPSTIVIGGGVSAAGDFLLDGVRKVYEENSFPQVRTSTKLA
LATLGNDAGVIGAASLVLQ
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaaaaaataatcggaattgaccttggtggaacatctattaagtttgctattttg
acttcagagggcgaaattcaagaaaaatggtccattaaaaccaatattttggacgaagga
agccacatcgtagaggatatgattgagtcaatcctgcatcgtttggacttgcttcagctt
tcagcagaggattttatcggaattggtatgggatcgccaggagttgttgaccgagaaaag
ggcactgttattggtgcttacaacctcaattggaagacgctgcagccagtcaaggataag
attgaaaaagcgactgggattcctttctatattgacaacgatgctaacgttgctgctttg
ggcgaacgctggatgggcgctggagaaaaccagcctgatgttgtcttcatgacactagga
acaggtgttggcggaggaatcgttgcagaaggcaagctcttgcacggacttgctggagca
gcaggagagttgggtcatatcactgttgacttcgatcagccgattcaatgtacctgtggc
aagaagggatgcttggagacggttgcatccgcgactggtattgtcaatctgactcgccgc
tatgctgatgagtatgctggtgatgctgagctgaaaaaactgattgacaacggtgaagat
gtcaatgcaaaagttgtctttgacttggcgaaagagggcgatgagctggctctgattgtc
tatcgcaatttcgctcgctatctaggtattgcctgtgccaatatcggctctatcctaaat
ccatctacaatcgttatcggaggtggcgtatcagctgcaggtgatttcttacttgatggc
gttcgcaaggtttatgaagagaatagcttcccgcaggttcgtacttcaaccaagttggcc
ttggctactcttggaaatgatgctggcgttatcggggcagcttcattggtattacaataa

DBGET integrated database retrieval system