KEGG   Streptococcus sanguinis: SSA_1144Help
Entry
SSA_1144          CDS       T00473                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
ssa  Streptococcus sanguinis
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ssa00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SSA_1144
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SSA_1144
Enzymes [BR:ssa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SSA_1144
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1173739..1175700)
Genome map
AA seq 653 aa AA seqDB search
MKQGITPQYWKQENNGRYFTKETQIFSPLPILTDTLLAHPKSRNDGQLAFPAIHFIEGIS
REVGQEVMQSFSLPYPSNPEAHIVKVAQDGIFVYALSQRGLFYGAISIIQMLQDGYLPYG
LAYDEPVCSERGLKVFLPSRKNMDFFKQFVDMLAFFKYNTIMIEIGGAMEYKKHPEINQE
WIKYCADMAEYSGKTKEIQDYTFPWYKNAIHMENGDGEFLSQNDVKDLVLYCKERFFEVI
PEVPSLGHCDYLMLGHPEIAEIPEDPYPDTYCPSNPASYELLFDVLDEIIEVFEPEIINI
GHDEYYSIAMCERCKGKAGADIFAEDIIKIYDYLKQKNVRTMIWGDKLLKNAIVPDAGPF
GGAEIIMYTPQFKKDTGKKVGIMPATWQAIHQIPKDVEILHWLWSLDEKLEDEVLEEGFS
IRYGNFEGYLFPHWAEHLKKGSKGAIISNWSTLNEVILQRNVIFFGLAYAYEMFWNHDYR
DEDYATIRDKTLSYLFHYHYPDLQNHTRSLEALAHPSWIEVSYATDYFVEYQWFVDGVFP
EMETYQIGNILLTYADQTEFTLPIIFGENIGKTSVNWDRSTNTNPLPGEPIYKVDEQLFE
VSLRTKPYQKDGQTFFAFPIQNPYPEKELKNVEVQTEANKDCQIFVDRIAYYH
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaggcatcacacctcaatattggaaacaagaaaacaacggtcgctatttcact
aaagaaactcaaatatttagtccacttcctattttgaccgacactttactggctcatcca
aaatcaagaaatgatggccagctggctttccctgccattcatttcatagaagggatttcc
cgagaagtcggacaagaggtcatgcagtccttttcacttccctatccatccaaccctgaa
gcgcacatcgtaaaggttgctcaagacggcattttcgtttatgccttgtcccagcgtggc
ttattttatggggccatttcaattattcaaatgttgcaggatggctacttgccttatggc
ttggcctacgacgaacctgtttgttccgagcgtggtctcaaggtctttttaccgtctcgt
aagaatatggatttcttcaagcaatttgtggatatgcttgcttttttcaagtacaatacg
attatgattgaaatcggcggtgctatggaatataaaaaacaccctgaaattaatcaagag
tggattaaatattgtgctgatatggctgaatactctggcaagaccaaagaaatccaagac
tataccttcccttggtacaagaatgccattcacatggagaatggtgacggggagtttcta
agtcaaaatgatgtgaaagatctggtcctctactgcaaggaacgattttttgaagtgatt
cctgaagtgccatccctcggtcactgcgattatttgatgcttggtcacccagaaatcgca
gaaatccctgaagatccttatccggatacttactgcccatcaaatcctgcctcttatgaa
ctcctatttgatgttctggatgaaatcattgaggtctttgaacctgaaatcatcaatatc
ggacatgatgaatactattcaattgccatgtgtgagcgctgcaaagggaaggctggagct
gatatctttgcagaggacattatcaagatttatgactacctcaagcagaaaaatgtccga
accatgatttggggagacaagcttctgaaaaacgctatcgttcctgatgcagggcctttt
ggtggagcagaaatcatcatgtacactccccagttcaaaaaagatacaggcaaaaaagtt
ggcatcatgccggcaacctggcaggccattcaccagattcccaaagatgtcgaaattctt
cattggctctggagtttggatgaaaaactggaagatgaagttttggaagaaggctttagc
atccgttatggtaattttgaaggctatctctttccgcattgggctgagcatttgaagaag
gggagcaagggagctatcatctccaactggagcaccttaaacgaggtaatactgcagaga
aatgtcattttcttcggcttggcctatgcttacgagatgttttggaatcatgactatcgt
gatgaagactatgcgactatccgtgataaaaccttatcttatctcttccattaccactat
cccgacctgcaaaaccacacgcgcagtcttgaagcactggcgcaccctagctggattgaa
gttagctatgctactgactattttgtggaataccaatggtttgttgatggcgtcttccct
gaaatggaaacctatcaaatcggaaatatcctactaacctatgctgatcaaaccgagttt
actcttcccattatctttggagaaaacattggcaaaacaagcgttaactgggatcggtct
accaataccaaccctctacctggcgaacccatctataaggtggatgaacaattatttgaa
gtttcgcttagaaccaaaccttatcagaaagacggtcagaccttctttgcatttcctatt
caaaacccttatcctgaaaaggaattgaagaatgtagaggttcaaacagaagctaacaaa
gattgtcaaatttttgttgatcgaattgcctattatcactaa

DBGET integrated database retrieval system