KEGG   Streptococcus sanguinis: SSA_1149Help
Entry
SSA_1149          CDS       T00473                                 

Definition
glycosyl hydrolase family protein (EC:3.2.1.21)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ssa  Streptococcus sanguinis
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:ssa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSA_1149
Enzymes [BR:ssa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     SSA_1149
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1178539..1179936
Genome map
AA seq 465 aa AA seqDB search
MTKFSRDFLWGSASAAYQVEGAWDEDGKSLSIWDVFVRQPNRTFKNTTGDVAVDHYHHYK
EDVKLMAEMGLKAYRFSIAWTRILPEGRGEVNQKGIEFYSNLIDELLKYNIEPIITIYHW
DLPQVLQDEYGGWESRKIIDDFLYYAEVLFENFGDRVKYWIGLNEQNVFVGLGYRDGRFP
PGIKNIQLMHQVNHIVNLANATIIKRFHDLKIKGQIGPSFAFPVLYALDNQPENVLAMEK
SLDVNVWYWMDAYLLGRYPRTALAYLKNQFGIELDIREGDLDILKAGRPDFVGVNYYQSH
TFAANVPNAEAGEPDQFKHVQNEHLERTSWGWEIDPIGLRIALRRITSRYDIPIMITENG
LGEYDTLTEDRKIHDPYRIEYLDNHITAVQNAIEDGCQVIGYCTWSFTDLLSWLNGYGKR
YGFVYVDRDEEEGGSLERIRKDSFYWYQKLIKEFESKRENSRTHS
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
gtgacaaaattttccagagactttctctggggatcggcttcagctgcctatcaagttgaa
ggagcttgggatgaagatggtaagagcctatctatatgggacgtctttgttcgccagcct
aataggacttttaaaaacacgactggcgacgtggcagtggaccattaccatcactataaa
gaagatgttaaactgatggcagaaatgggtctgaaagcttatcgtttttctattgcttgg
acccgtattttgcctgagggacgaggagaggtcaatcagaaagggattgaattttattca
aatctgattgatgaacttctcaaatataatattgaacccattatcacaatctatcactgg
gatttacctcaagtactgcaagatgagtacggcggttgggaatccagaaaaataattgac
gatttcctgtattatgcagaggttctctttgaaaactttggagatcgagtgaaatattgg
attggactcaatgagcaaaatgtctttgttggactaggttatcgggatggtcgttttcca
ccaggaatcaaaaatattcagttaatgcatcaggtaaatcacattgtcaacttggctaat
gcaacgattatcaaacgattccatgatttgaaaataaaaggtcaaatcggtccaagcttt
gcttttcctgtcctctatgctctggataatcagccagaaaatgtcctagccatggagaaa
tctttggatgtcaatgtttggtattggatggatgcttatttattaggacgttatccaagg
acagctctagcttatttgaaaaatcaattcggtatagaattagatatccgagaaggagat
ttagatattttaaaagctggccgtcctgatttcgtaggcgtcaactattaccaatcccat
acttttgctgctaatgttccgaatgctgaagctggagagccggaccagtttaagcatgtg
caaaatgaacacttagagcgtaccagctggggatgggaaatagatccaattggtttacgg
atagctttgcgacggattaccagcagatatgatattccaattatgataactgaaaatggg
ctaggagagtatgacaccttaacagaagatagaaagatccacgacccatatcggattgaa
tatcttgataaccatattacagctgtacaaaatgccatcgaagatggttgccaagtcatc
ggctattgtacttggtctttcacagatctactttcatggctcaacggctatggcaagcgc
tatggatttgtttatgtagaccgtgatgaggaagaaggaggtagtctagagcggattcga
aaagatagtttttattggtatcaaaaattaattaaagaatttgagagcaaaagagagaat
agtaggactcattcatag

DBGET integrated database retrieval system