KEGG   Streptococcus sanguinis: SSA_1178Help
Entry
SSA_1178          CDS       T00473                                 

Gene name
acoA
Definition
acetoin dehydrogenase, E1 component subunit alpha (EC:1.2.4.1)
Orthology
K00161  
pyruvate dehydrogenase E1 component alpha subunit [EC:1.2.4.1]
Organism
ssa  Streptococcus sanguinis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ssa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SSA_1178 (acoA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSA_1178 (acoA)
   00020 Citrate cycle (TCA cycle)
    SSA_1178 (acoA)
   00620 Pyruvate metabolism
    SSA_1178 (acoA)
Enzymes [BR:ssa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     SSA_1178 (acoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1205539..1206507)
Genome map
AA seq 322 aa AA seqDB search
MATLDKNLLLEMFRKMEEIRRMDLKIAQLVKKGKVPGMTHFSVGEEAANVGAMLALNEDD
LLTSNHRGHGQAIAKGINLNEMMAEILGKYTGTCKGKGGSMHIADLDAGNLGANGIVGGG
MGIAVGAALTQQMQKTGKIVVCFFGDGATNEGVFHEAVNMASIWNLPVIFYCINNGYGIS
ADIKKMTNVEHIHERSAAYGIPGMFIEDGNNVLDVYEGFQKAVEHVRSGKGPVLIESVTY
RWLGHSSSDPGKYRTREEVEEWKKKDPIENLRKYLLENKIASEEELEAIQARVKEAVEAS
VKFAEESPFPPLESAFEDIYAD
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggcaactttagataaaaatcttttgttagagatgttccgtaagatggaagaaatccgt
cgcatggacttaaaaattgctcaacttgtaaaaaaaggaaaggttcctgggatgactcac
ttctcagtaggtgaggaagcagccaatgtcggtgctatgctggccttaaatgaggatgat
ttgctgacttctaatcaccggggacacggtcaagctatcgccaaaggaatcaacctcaac
gaaatgatggctgaaatccttggtaaatacactggaacctgtaaaggaaaaggcggctct
atgcacattgctgacctagatgctggaaatcttggtgctaatggtatcgtaggtggtggc
atgggaattgctgtcggagcagctctgacccagcaaatgcagaagacaggtaagatagtt
gtctgcttttttggtgacggggctaccaacgaaggtgtcttccacgaagcagtcaacatg
gcttccatctggaatctacccgtaattttctattgtatcaataacggctatggtatttct
gctgacatcaagaaaatgaccaatgtagagcacatccacgagcgcagcgcagcttatggc
attccaggaatgttcatcgaagatggcaataatgttttggatgtctatgaaggcttccaa
aaagctgtagagcatgttcgcagtggtaaaggacctgtcttgattgagagcgtgacttat
cgttggttgggacactcgtcttccgacccaggtaaataccgtactcgtgaagaagtagaa
gaatggaagaaaaaagatccaatcgaaaatcttcgtaaatacttgctggaaaacaagatt
gcaagcgaggaagagctggaagctatccaagctagagtaaaagaagcagtagaagcgtct
gtgaagttcgcagaagaaagcccgttcccgccgcttgaatctgcctttgaagatatttac
gcagactaa

DBGET integrated database retrieval system