KEGG   Streptococcus sanguinis: SSA_1178Help
Entry
SSA_1178          CDS       T00473                                 

Gene name
acoA
Definition
(RefSeq) acetoin dehydrogenase, E1 component subunit alpha
  KO
K21416  
acetoin:2,6-dichlorophenolindophenol oxidoreductase subunit alpha [EC:1.1.1.-]
Organism
ssa  Streptococcus sanguinis
Brite
Enzymes [BR:ssa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     SSA_1178 (acoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
complement(1205539..1206507)
Genome map
AA seq 322 aa AA seqDB search
MATLDKNLLLEMFRKMEEIRRMDLKIAQLVKKGKVPGMTHFSVGEEAANVGAMLALNEDD
LLTSNHRGHGQAIAKGINLNEMMAEILGKYTGTCKGKGGSMHIADLDAGNLGANGIVGGG
MGIAVGAALTQQMQKTGKIVVCFFGDGATNEGVFHEAVNMASIWNLPVIFYCINNGYGIS
ADIKKMTNVEHIHERSAAYGIPGMFIEDGNNVLDVYEGFQKAVEHVRSGKGPVLIESVTY
RWLGHSSSDPGKYRTREEVEEWKKKDPIENLRKYLLENKIASEEELEAIQARVKEAVEAS
VKFAEESPFPPLESAFEDIYAD
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggcaactttagataaaaatcttttgttagagatgttccgtaagatggaagaaatccgt
cgcatggacttaaaaattgctcaacttgtaaaaaaaggaaaggttcctgggatgactcac
ttctcagtaggtgaggaagcagccaatgtcggtgctatgctggccttaaatgaggatgat
ttgctgacttctaatcaccggggacacggtcaagctatcgccaaaggaatcaacctcaac
gaaatgatggctgaaatccttggtaaatacactggaacctgtaaaggaaaaggcggctct
atgcacattgctgacctagatgctggaaatcttggtgctaatggtatcgtaggtggtggc
atgggaattgctgtcggagcagctctgacccagcaaatgcagaagacaggtaagatagtt
gtctgcttttttggtgacggggctaccaacgaaggtgtcttccacgaagcagtcaacatg
gcttccatctggaatctacccgtaattttctattgtatcaataacggctatggtatttct
gctgacatcaagaaaatgaccaatgtagagcacatccacgagcgcagcgcagcttatggc
attccaggaatgttcatcgaagatggcaataatgttttggatgtctatgaaggcttccaa
aaagctgtagagcatgttcgcagtggtaaaggacctgtcttgattgagagcgtgacttat
cgttggttgggacactcgtcttccgacccaggtaaataccgtactcgtgaagaagtagaa
gaatggaagaaaaaagatccaatcgaaaatcttcgtaaatacttgctggaaaacaagatt
gcaagcgaggaagagctggaagctatccaagctagagtaaaagaagcagtagaagcgtct
gtgaagttcgcagaagaaagcccgttcccgccgcttgaatctgcctttgaagatatttac
gcagactaa

DBGET integrated database retrieval system