KEGG   Streptococcus sanguinis: SSA_1523Help
Entry
SSA_1523          CDS       T00473                                 

Gene name
basA
Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ssa  Streptococcus sanguinis
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ssa00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    SSA_1523 (basA)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SSA_1523 (basA)
Enzymes [BR:ssa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     SSA_1523 (basA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1532207..1532680
Genome map
AA seq 157 aa AA seqDB search
MTNIYDIEIQKQDGSLQKMSNYKGKILLIVNTATGCGFTPQYQELQELYERYQEEGFDIL
DFPCNQFGQQTPGDAAEINNFCSLNYGTTFPRFAKIDVNGPHTAPLFDWLKKEKGGLLGE
KIKWNFTKFLVSRDGTVIKRFSPQTSPKKIEELVQKL
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgacaaacatttatgatatcgaaatccaaaaacaagacggaagtctgcaaaaaatgagt
aattataaaggaaagattctgctgattgtcaatacagcgaccggctgcggcttcactcct
cagtaccaagaactgcaggaactctatgagcgctaccaggaagaagggtttgatattctg
gatttcccctgcaatcagtttggccagcagacccctggagacgctgcagaaatcaacaac
ttttgcagccttaactatggaacgacctttcctcgatttgctaagattgatgtcaacggt
cctcatactgctccactctttgactggctcaaaaaagaaaagggcggtcttctgggtgaa
aagatcaaatggaatttcacaaagtttctggtcagccgagacggaacagtcatcaaacgt
ttctctccacaaacctctcccaaaaagatagaagaactcgtccaaaagctataa

DBGET integrated database retrieval system