KEGG   Streptococcus sanguinis: SSA_1827Help
Entry
SSA_1827          CDS       T00473                                 

Gene name
glp
Definition
alpha-glycerophosphate oxidase (EC:1.1.3.21)
Orthology
K00105  
alpha-glycerophosphate oxidase [EC:1.1.3.21]
Organism
ssa  Streptococcus sanguinis
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:ssa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SSA_1827 (glp)
Enzymes [BR:ssa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.21  glycerol-3-phosphate oxidase
     SSA_1827 (glp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1816252..1818078
Genome map
AA seq 608 aa AA seqDB search
MEFSKKTRELSIKKMQERTLDLLIIGGGITGAGVALQAAASGLETGLIEMQDFAEGTSSR
STKLVHGGLRYLKQFDVEVVSDTVSERAVVQQIAPHIPKPDPMLLPVYEEEGATFSLFRL
KVAMDLYDLLAGVNNTPAANKVLSKEEVLEREPELKKEGLVGGGVYLDFRNNDARLVIEN
IKRANQDGALIANHVKAEGFLFDESGKITGVVARDLLTDEVFEIKARLVINTTGPWSDKV
RNLSNDGEQYSQMRPTKGVHLVVDSSKIKVSQPVYFDTGLGDGRMVFVLPRENKTYFGTT
DTDYTGDLEHPKVTQEDVDYLLGIVNNRFPEANITIDDIESSWAGLRPLIAGNSASDYNG
GNNGTISDESFNALIATVESYLAKEKSREDVEAAVTKLESSTSEKHLDPSAVSRGSSLER
DNNGLLTLAGGKITDYRKMAEGAMERVVEILKAEFDRSFKLINSKTYPVSGGELNPANVD
SEIEAFAQLGVSRGLDSKEAFYLANLYGSNAPKVFALAHSIEQAPGLSLADTLSLHYAMR
NELALSPVDFLLRRTNHMLFMRDSLDSIVEPVLDEMGRFYDWTEEEKAAYRKDVQAALAN
NDLEELKK
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atggaattttcaaagaaaacacgtgaattatcgataaaaaaaatgcaggaacgcaccttg
gacctcctgattatcggtggtgggattaccggtgctggggtagccttgcaagcggcagct
agtggactggagaccggtctgattgaaatgcaggactttgcagaagggacttctagccgt
tctaccaaattggtccacggaggtcttcgttacctcaagcaattcgacgtagaggtggtc
tcagatacagtttcagagcgtgctgtggtacagcaaattgcccctcatattccaaaacca
gatccaatgctacttcctgtctacgaagaagagggcgctaccttcagtctcttccgtctt
aaagtagctatggacctctacgacctcttggccggtgtcaacaacactcctgctgccaac
aaggtcttgagtaaggaagaagtgctagaacgggagcctgaactcaagaaggaaggcctg
gtcggcggcggtgtctatcttgacttccgcaacaacgatgctcgccttgtgattgaaaat
atcaaacgcgccaaccaagacggtgctctcattgccaaccacgttaaggcagaaggcttc
ctctttgatgaatccggaaagattacaggtgttgttgcgcgtgacctcttgacggatgaa
gtctttgaaatcaaggctcgcttggtcatcaacacaactggaccttggagcgacaaggtg
cgcaatctgtcaaatgatggtgagcaatactcacaaatgcgtccaaccaagggtgttcac
ttggtagttgactctagcaagatcaaggtttctcagccagtctactttgacacaggcttg
ggagacggccggatggtctttgttcttccacgtgaaaataaaacctactttggtacgact
gacactgactacactggtgacctggagcatccaaaagtaacacaagaagatgtagattac
ctcttgggcattgtcaataatcgcttcccagaagcaaacatcacaattgacgacatcgaa
agtagctgggctggcctgcgtcctctaatcgcaggaaacagtgcttctgactacaacggc
ggaaacaacggtaccattagcgacgaaagtttcaatgcactgattgcgaccgttgaaagc
tatttggctaaagaaaaatcccgtgaggatgtcgaagcggctgttaccaaactcgaaagc
agcacttctgaaaaacacttggatccatctgctgtgtcccgcggttccagcttggaacgt
gataacaatggcctcttgacccttgccggtggtaagattacggactatcgtaagatggct
gaaggcgccatggagcgcgtggttgaaatccttaaagcggaatttgaccgcagcttcaag
ctcatcaactctaagacctaccctgtttcaggcggagagctcaatccagcaaatgtggat
tccgaaatcgaagcttttgctcaacttggtgtctcacgcggcttagacagcaaagaagcc
ttctatcttgcaaacctttacggttcaaatgctcctaaagtctttgccctcgcacacagc
atcgagcaagcaccaggtctcagcctagcggataccttgtcactgcattatgctatgcgt
aacgaattagcactcagccctgttgacttcctgctgcgccggacaaaccacatgctcttt
atgcgggacagtttagatagcatcgttgagccagttctggatgaaatgggacggttctac
gactggacagaagaagaaaaagcagcttatcgaaaagatgttcaagctgcccttgcaaat
aacgatttagaagaattaaaaaaatag

DBGET integrated database retrieval system