KEGG   Streptococcus sanguinis: SSA_1829Help
Entry
SSA_1829          CDS       T00473                                 

Definition
RNA methyltransferase (EC:2.1.1.-)
Organism
ssa  Streptococcus sanguinis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1819049..1820419)
Genome map
AA seq 456 aa AA seqDB search
MNVKVKQRIPLKIKKMGINGEGIGFYKKTLVFVPGALKGEEVYCQVTRVQRNFIEAKLLT
INKRSKFRVEAPCEIYDSCGGCQIMHLHYDKQLEFKEDLLRQALKKFAPAGYENYEIRPT
IGMQEPLYYRAKLQFQTRKFKDEVKAGLYAQNSHYLVSLKNCLVQDKVTQQIINKVARLL
GKYRLPIYDERKTAGVRTVMIRRARKTGQVQMIFVTGRKLDFSPVVRDLVAEFPELETVA
VNYHTSKSSEIYGDKTEIIWGEKAIQEGVLDYEFSLSPRAFYQLNPEQTEVLYGEAVKAL
DVTKEDHLIDAYCGVGTIGFAFAKRVKSLRGMDIIPEAIEDAKRNAKKMGFDNTLYEAGT
AEEIIPRWYAEGYRADALIVDPPRTGLDDKLLETIVRYAPEKMVYVSCNVSTLARDLVKL
CQVYDVHYIQSVDMFPHTARTEAVVKLSKRNSTRLS
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtgaaagtgaagcaaagaatccctttgaaaattaagaaaatggggattaatggg
gaagggattggattttataagaaaacgctggtctttgtgccaggggctttgaagggtgaa
gaagtctactgtcaggtgaccagggttcagcgtaatttcatcgaggccaagctcttgacc
atcaacaagcggtcaaaatttcgggtggaagcaccttgtgagatttatgatagctgtggg
ggctgtcaaatcatgcacctccattatgacaagcagttggagtttaaggaagatttgctg
cgtcaggccttgaaaaaatttgcgccagctggctatgagaactatgagattcgtccgacc
attggtatgcaggagccgctctattatcgggctaagctgcagtttcagactcggaagttc
aaggatgaggtcaaggcggggctctatgcccagaattcccactatctggtctcgctgaaa
aactgtctggttcaggacaaggtgacgcaacagatcataaataaggtggctcggctttta
ggcaagtataggctgcccatctatgatgagagaaagactgctggagtgcgcaccgttatg
attcgcagggccagaaagacaggtcaggtgcagatgatttttgtgacggggcgtaagctg
gacttttctccagtcgttcgagacctggtggctgaatttccagagttggagacagtggcg
gtcaattatcatacgagcaagtccagtgagatttacggggataagacagagattatctgg
ggcgagaaggccatccaagaaggagtgctggactatgagttctccctatcgcctcgagct
ttctatcagctcaatcctgagcagacagaggtgctctacggggaggcggttaaggcgctg
gatgtgacgaaagaagatcatttgattgatgcctattgcggagtggggaccatcggcttt
gcctttgctaaaagggttaagtctctgcgtggcatggacatcatccctgaggccattgaa
gacgccaagcgcaatgcaaaaaagatgggctttgacaatacactctacgaagctggaacg
gcagaggagattattcctcgttggtacgctgaaggttatcgggcggatgccttgattgtt
gacccaccgcgaactggtctggacgataaactgctggagacgattgtccgttatgcacct
gaaaagatggtctacgtttcctgcaatgtctcaactctggctcgggatctggtcaagctt
tgtcaggtctacgatgtccactacatccagtcggttgatatgtttccgcatactgctcgg
accgaggcagtagtgaaattgtctaagagaaatagcactcgtttgagttaa

DBGET integrated database retrieval system