KEGG   Streptococcus sanguinis: SSA_1829Help
Entry
SSA_1829          CDS       T00473                                 

Definition
RNA methyltransferase (EC:2.1.1.-)
Orthology
K00599  
[EC:2.1.1.-]
Organism
ssa  Streptococcus sanguinis
Pathway
Histidine metabolism
Tyrosine metabolism
Polycyclic aromatic hydrocarbon degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ssa00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    SSA_1829
   00350 Tyrosine metabolism
    SSA_1829
  Xenobiotics biodegradation and metabolism
   00624 Polycyclic aromatic hydrocarbon degradation
    SSA_1829
Enzymes [BR:ssa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     SSA_1829
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1819049..1820419)
Genome map
AA seq 456 aa AA seqDB search
MNVKVKQRIPLKIKKMGINGEGIGFYKKTLVFVPGALKGEEVYCQVTRVQRNFIEAKLLT
INKRSKFRVEAPCEIYDSCGGCQIMHLHYDKQLEFKEDLLRQALKKFAPAGYENYEIRPT
IGMQEPLYYRAKLQFQTRKFKDEVKAGLYAQNSHYLVSLKNCLVQDKVTQQIINKVARLL
GKYRLPIYDERKTAGVRTVMIRRARKTGQVQMIFVTGRKLDFSPVVRDLVAEFPELETVA
VNYHTSKSSEIYGDKTEIIWGEKAIQEGVLDYEFSLSPRAFYQLNPEQTEVLYGEAVKAL
DVTKEDHLIDAYCGVGTIGFAFAKRVKSLRGMDIIPEAIEDAKRNAKKMGFDNTLYEAGT
AEEIIPRWYAEGYRADALIVDPPRTGLDDKLLETIVRYAPEKMVYVSCNVSTLARDLVKL
CQVYDVHYIQSVDMFPHTARTEAVVKLSKRNSTRLS
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtgaaagtgaagcaaagaatccctttgaaaattaagaaaatggggattaatggg
gaagggattggattttataagaaaacgctggtctttgtgccaggggctttgaagggtgaa
gaagtctactgtcaggtgaccagggttcagcgtaatttcatcgaggccaagctcttgacc
atcaacaagcggtcaaaatttcgggtggaagcaccttgtgagatttatgatagctgtggg
ggctgtcaaatcatgcacctccattatgacaagcagttggagtttaaggaagatttgctg
cgtcaggccttgaaaaaatttgcgccagctggctatgagaactatgagattcgtccgacc
attggtatgcaggagccgctctattatcgggctaagctgcagtttcagactcggaagttc
aaggatgaggtcaaggcggggctctatgcccagaattcccactatctggtctcgctgaaa
aactgtctggttcaggacaaggtgacgcaacagatcataaataaggtggctcggctttta
ggcaagtataggctgcccatctatgatgagagaaagactgctggagtgcgcaccgttatg
attcgcagggccagaaagacaggtcaggtgcagatgatttttgtgacggggcgtaagctg
gacttttctccagtcgttcgagacctggtggctgaatttccagagttggagacagtggcg
gtcaattatcatacgagcaagtccagtgagatttacggggataagacagagattatctgg
ggcgagaaggccatccaagaaggagtgctggactatgagttctccctatcgcctcgagct
ttctatcagctcaatcctgagcagacagaggtgctctacggggaggcggttaaggcgctg
gatgtgacgaaagaagatcatttgattgatgcctattgcggagtggggaccatcggcttt
gcctttgctaaaagggttaagtctctgcgtggcatggacatcatccctgaggccattgaa
gacgccaagcgcaatgcaaaaaagatgggctttgacaatacactctacgaagctggaacg
gcagaggagattattcctcgttggtacgctgaaggttatcgggcggatgccttgattgtt
gacccaccgcgaactggtctggacgataaactgctggagacgattgtccgttatgcacct
gaaaagatggtctacgtttcctgcaatgtctcaactctggctcgggatctggtcaagctt
tgtcaggtctacgatgtccactacatccagtcggttgatatgtttccgcatactgctcgg
accgaggcagtagtgaaattgtctaagagaaatagcactcgtttgagttaa

DBGET integrated database retrieval system