KEGG   Streptococcus sanguinis: SSA_1917Help
Entry
SSA_1917          CDS       T00473                                 

Gene name
adh
Definition
(RefSeq) alcohol dehydrogenase (EC:1.1.1.1)
  KO
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ssa  Streptococcus sanguinis
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ssa00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SSA_1917 (adh)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSA_1917 (adh)
  Lipid metabolism
   00071 Fatty acid degradation
    SSA_1917 (adh)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SSA_1917 (adh)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SSA_1917 (adh)
   00626 Naphthalene degradation
    SSA_1917 (adh)
Enzymes [BR:ssa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SSA_1917 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1906657..1907676
Genome map
AA seq 339 aa AA seqDB search
MKAVVVNPEGTNVQLIENKELRPLETGEALVDIEYCGVCHTDLHVAHGDFGKVPGRVLGH
EGIGIVKEIAPDVKSLKVGDRVSVAWFFEGCGTCEYCTTGRETLCRTVKNAGYSVDGGMA
EQCIVTADYAVKVPEGLDPAQASSITCAGVTTYKAIKEAQLQPGQWTVIFGAGGLGNLAV
QYAKKVFNAHVVAVDINNDKLALAKEVGADIVINGHEVEDVAALIQEKTGGAHSAVVTAV
SKVAFNQAVDSVRAGGRVVAVGLPSEMMDLSIVKTVLDGIQVIGSLVGTRKDLEEAFQFG
AEGLVAPVVQKRPVSDAVDVFDEMEAGTIQGRMVLDFTH
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagttgttgtaaatccagaaggaaccaatgtccaactcatcgaaaataaggaa
cttcgtcctcttgaaacaggggaagctctcgttgacattgaatactgcggtgtctgccat
actgatttacacgtcgcgcatggtgactttggtaaggtaccgggtcgcgttcttgggcat
gaaggtatcggtattgtcaaagaaatcgctccagatgtaaaaagtctcaaggtcggagac
cgcgtcagtgtcgcttggttctttgaaggctgcggcacttgtgaatactgtacaactggt
cgcgaaaccctttgccgtacagtaaaaaatgctggttactctgttgacggtgggatggca
gagcaatgtatcgtaacagccgattatgctgtcaaagttcctgaaggactggatcctgcc
caagcttcttctatcacttgtgccggcgtaacgacctacaaggctatcaaagaggcccag
ctgcagccagggcaatggacagttatctttggagcaggtggattaggtaacctagcggtt
caatatgccaagaaagtctttaatgcccatgttgtcgctgttgatatcaacaatgataag
ctcgctctggccaaagaagtcggtgctgatatcgtcatcaacggccatgaagttgaagat
gtcgctgctcttatccaagaaaaaactggcggtgcgcattctgccgtagtaacagccgtt
tctaaagttgccttcaaccaagctgttgattctgttcgtgctggcggtcgggtagttgct
gttggattgccatctgaaatgatggacctcagcattgtcaaaactgttttagatggtatc
caagtcattggttccctcgttggtacacgcaaggacttggaagaagccttccagtttggt
gctgaaggattagtggctcctgtcgttcaaaagcgccctgtttcagatgctgtggatgtc
tttgacgaaatggaagcgggtactattcagggacgtatggtccttgacttcacacactaa

DBGET integrated database retrieval system