KEGG   Streptococcus sanguinis: SSA_2169Help
Entry
SSA_2169          CDS       T00473                                 

Gene name
galU
Definition
glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ssa  Streptococcus sanguinis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ssa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SSA_2169 (galU)
   00052 Galactose metabolism
    SSA_2169 (galU)
   00500 Starch and sucrose metabolism
    SSA_2169 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    SSA_2169 (galU)
Enzymes [BR:ssa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SSA_2169 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2168586..2169545
Genome map
AA seq 319 aa AA seqDB search
MNLRLRTNGLRSNRKEIIMSKVKKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIV
EEALKSGIEDILVVTGKSKRSIEDHFDSNFELEYNLKEKGKDDLLKLVDETTGIGLHFIR
QSHPRGLGDAVLQAKAFVGNEPFVVMLGDDLMDITNDKAVPLTKQLIDDYEATHASTIAV
MQVPHDEVSSYGVIAPQGEGVKGLYSVETFVEKPKPEDAPSDLAIIGRYLLTPEIFEILE
KQEPGAGNEIQLTDAIDTLNKTQRVFAREFKGDRYDVGDKFGFMKTSIDYALKHPQVKDS
LKQYIIDLGHKLEKKQEKK
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaaggctgagaacgaatggacttcgttctaatagaaaggaaataattatgtca
aaagttaagaaagccgtcatccctgcagctggtctcggaacccgcttcctgccagctacc
aaagcactagccaaagaaatgttgccgatcgttgacaagccaaccatccagtttatcgtc
gaggaagctctcaaatctggaattgaagatattctagttgtcacaggtaagtcaaaacgc
tccatcgaagaccactttgactcaaactttgaattagaatacaatctcaaagaaaagggt
aaagacgatttgctcaaattagttgatgaaaccactggtatcggtctgcacttcatccgt
caaagccatccgcgcggactgggagatgctgtccttcaggccaaggctttcgtaggaaac
gagcctttcgttgtcatgctgggcgatgatctcatggacatcaccaatgataaggctgtg
ccgctgaccaagcaattgattgatgattacgaggctactcacgcctctaccatcgctgtc
atgcaggtccctcatgatgaagtttcctcttatggtgtgattgcccctcaaggcgaaggt
gtcaaaggtctttacagcgtggaaaccttcgtcgaaaaaccaaaacctgaggatgcaccg
agtgatttggctattatcggccgctacctgctgacaccagaaatttttgaaatcttggaa
aagcaagagccaggtgctggaaatgagattcagctgaccgatgcaattgatactctcaac
aagacgcagcgcgtcttcgctcgcgaattcaagggcgatcgctatgatgtcggtgacaag
ttcggcttcatgaagacttccatcgactacgccctcaagcatccgcaggtcaaagactcc
ttgaagcagtatatcattgacttaggtcataaactagagaaaaaacaagagaaaaaataa

DBGET integrated database retrieval system