KEGG   Spiroplasma sabaudiense: SSABA_v1c01770Help
Entry
SSABA_v1c01770    CDS       T03048                                 

Definition
(GenBank) hypothetical protein
  KO
K13381  
bifunctional chitinase/lysozyme [EC:3.2.1.14 3.2.1.17]
Organism
ssab  Spiroplasma sabaudiense
Pathway
Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:ssab00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SSABA_v1c01770
Enzymes [BR:ssab01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.14  chitinase
     SSABA_v1c01770
    3.2.1.17  lysozyme
     SSABA_v1c01770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
UniProt: 
Position
209416..212361
Genome map
AA seq 981 aa AA seqDB search
MKKLLIVLSSLVITAPTAATVVSCNWSTGNKIVPEGKIEIGSEWTGKNEIDSKNGSKRSK
TNKTSEVLTTNQGAKKGSSARSASSTLLKSTIGNENLIGNNLNKSNNPVFKPYADIGIVE
DSVEYALKWHSKSGASYEEAKKILEAEGQDVVNYNNLAQISNDKSLIDSANGDGIVLGFM
QNASDKGELSPMWDAAPKDFNNNQSEKWFQERFDGWKKEGLNTKNMTISFGPFANSLWHT
AYQNNLTEEEFADQLTLISEAYGTRSFDFYFAAPYLTTQGSYKESQKLLAGALKILLERA
EAAGETTNQWDFRLSLVSSTKDGVATSPAFLQSGLEQHVGDEFSPLYVFTKYLGMNFKLN
LVTGYLTTDSQDPNGDWEVEQMKSAIETTQKNWLKTHEILNGNSNGLTSADVYKRMIVTP
WNGRRAENATYNFTPKDAAELRKFAIEKGVGELSMFYITRDHPSYFDSNNLPGNGLADLN
KIDQNIRSGAGYEEFAYAKALNGKLADASSLKEAASKTEVAKLKGYLDVDKINGNTKLQG
LESDGGWDGAGVGGETTLPGGGGDTGPTAPVDPGVVPNNKSLYRDRLDANPVRAKNNNWI
TQKTKNSSAYFSPYLDAGLWEGNNIDEIYNGSNGQSGVKGFDHLTLAFAQQVNKHNDSLE
ISFAGLEKNNEGYTYWEQNQLKAKVLDPIVKKGHFKNIKVAYGGATTGGMTEKNPWNVAY
KLANGDFNKATEILTKGLTDFQKEIADLVGQPMTRAIDFDIEGHAQENINELRVLAKTLA
KMKKLDKRWDFSLTLPVLPTGLTPVGYKVLDIFVEEYNKAGLSWTDIPVTNLMLMDYGNP
MYLQAIAQGKTNFDLAKDALLSTKNNIATSIFNNYGETISIDKVYKLLAATPMIGVNDTV
EGVFTLEDAKELYNWANNVGLAYVSMWSMNDDRGRQNNINAVNKSLVTHGLAYLEQYDFA
RAFSGDWIDRVIKPRDKWSNN
NT seq 2946 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattactcatagttttatcaagtttagtaattacagcgccaacagccgcaacg
gttgtttcatgtaattggtcaactggtaataaaattgttccggaaggaaaaattgagatt
ggatcggaatgaactggtaagaatgaaatagattctaaaaacggttcaaaacgttcaaaa
acaaataaaacatcagaagtattaacaaccaaccaaggtgctaagaaagggtcatcagct
cgtagcgcctcatcaacattattaaaaagtactattggaaacgaaaatttaattggaaac
aatttaaataaatctaacaatccagtatttaagccatatgctgatattggaattgttgaa
gatagtgtcgagtatgctctaaaatgacatagtaagtcaggagcaagttatgaagaagct
aaaaaaattcttgaagccgaaggccaagatgttgtaaactacaacaatttagctcaaatt
tcaaatgacaaatcacttattgattctgctaatggagatggaattgttttaggatttatg
caaaatgcctcagataaaggtgaattatcaccaatgtgagatgcagcaccaaaagacttt
aacaataatcaatcagaaaaatgattccaagagcgttttgatggatgaaaaaaagaaggt
ctaaatacaaaaaatatgactatttcttttggtccatttgctaactcattgtgacataca
gcttaccaaaataacttaaccgaagaagaatttgcagatcaattaacattgatttcagag
gcttatggaactcgttcattcgacttttattttgcagcaccgtatttaacaactcaagga
agttataaagaatcacaaaaactacttgcaggagctttaaaaatcttgctagaacgtgct
gaagcagctggggaaactacaaatcaatgagatttccgtctatcacttgtttcatcaaca
aaagatggagttgcaacttcaccagctttcttacaaagtggtttagaacaacacgttggg
gatgaattctcaccattatatgtatttacaaaatacttgggaatgaacttcaaattaaac
ttagtaacaggatatttaacaactgattctcaagatccaaatggtgattgagaagttgaa
caaatgaaatcagctattgaaacaactcaaaaaaattgattgaaaactcatgaaatttta
aacggaaattcaaatggcttgacttcagctgacgtttataaacgtatgatcgtaacacca
tgaaatggtcgtcgtgcagaaaacgcaacttataactttacaccaaaagatgctgcagaa
ttacgtaaattcgcaattgaaaaaggtgttggagaattatcaatgttttatatcactcgt
gatcacccatcatactttgattcaaataacctaccaggaaatggattggcagatttaaat
aaaatcgatcaaaacattcgttctggagcaggttatgaagaatttgcttatgcaaaagct
ttaaatggtaaactagcagacgctagctcattaaaagaagcagcaagcaaaactgaagta
gctaaattaaaaggttacttagatgttgataaaatcaacggtaacacaaaacttcaaggt
ctagaatctgatggtggatgagatggagctggagttggaggagaaactactttacctggt
ggtggaggagatacaggtccaaccgcaccagttgatccaggagtagttccaaacaataaa
agtttatatcgtgatcgcttagatgcaaacccagttcgtgctaaaaacaacaactgaatc
acacaaaaaacaaaaaattcaagtgcttacttttcaccatatttagacgcaggtttatga
gaaggaaacaacattgatgaaatttacaatggttcaaatggacaatcaggagttaaaggt
tttgaccacttaactctagcatttgcacaacaagtaaacaaacacaatgatagtttagaa
atttcatttgctggtcttgaaaaaaataacgaaggttatacatattgagaacaaaatcaa
ttaaaagccaaagttttagatccaatcgttaaaaaaggtcactttaaaaatattaaagtt
gcctacgggggagctacaactgggggaatgactgaaaaaaatccttgaaatgttgcttac
aaactagcaaatggtgacttcaacaaagccacagaaatcttaactaaaggtttaacagat
ttccaaaaagaaatcgcagacttagttggacaaccaatgactagagcaattgactttgat
attgaaggtcatgcacaagaaaatattaatgaattacgtgttttagcaaaaactttagca
aaaatgaaaaaattagacaaaagatgagacttctcacttactctaccagttttaccaaca
ggattaactccagttggatataaagtattagacatttttgtagaagaatacaacaaagca
ggtctttcatgaactgatattccagtaacaaacctaatgttaatggattatggtaaccca
atgtacttacaagcaattgcgcaaggaaaaacaaactttgacctagcaaaagatgcttta
ttatcaactaaaaacaacatagcaacttcaattttcaataattatggtgaaaccatttca
attgataaagtttataaattattagcagcaacaccaatgattggtgtaaatgatactgtt
gaaggagtatttactttagaagatgctaaagaactttataactgagcaaacaatgttggt
ttagcttacgtttcaatgtgatcaatgaatgatgaccgtggacgtcaaaacaacatcaat
gctgttaacaaaagtcttgtaacacacggattagcttatttagaacaatacgactttgct
cgtgccttttcaggagactgaattgatcgtgtaattaaacctcgtgataaatgatcaaat
aattaa

DBGET integrated database retrieval system