KEGG   Spiribacter salinus: SPISAL_05160Help
Entry
SPISAL_05160      CDS       T02685                                 

Definition
flavin containing amine oxidoreductase-like protein
Orthology
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
ssal  Spiribacter salinus
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ssal00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SPISAL_05160
   00330 Arginine and proline metabolism
    SPISAL_05160
   00340 Histidine metabolism
    SPISAL_05160
   00350 Tyrosine metabolism
    SPISAL_05160
   00360 Phenylalanine metabolism
    SPISAL_05160
   00380 Tryptophan metabolism
    SPISAL_05160
Enzymes [BR:ssal01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     SPISAL_05160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1050574..1051668
Genome map
AA seq 364 aa AA seqDB search
MTDTPIVIIGAGLAGLTAARTIQAAGIKPIVLEASDRLGGRIDSLRAEDGQPLADLGPSW
VWPPFQPAVPRWLDALAVESFDQYDAGDAILDGFEDTPIRQPLPGQYGMARLVGGPSALV
KAMAAGLSDGVVQTQSPVSAVRLQNDGSLRIEGDNGLALSADRVILAVPLRLAAERIILP
DALPDRLREELKKTPTWMAAQAKAVVRYERPFWRERGLSGRIASRQGPLFEAHDHTSARG
DAALFGFVGTPVGHRDPALLEQAILAQLERCLGPEGGRPVELRVKDWAKDEWICSEADRT
GPQAHPNVGSERLRSGHLDHRLWFCAAETAAQSPGLIEGALLAGEAAGHAASAGLRRDAA
GDQQ
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaccgataccccaatcgttatcataggcgccggcctcgccggccttaccgcggcccgc
accatccaggccgccggcattaagcccatcgtactcgaggcgtctgatcgcctgggtggg
cgaatcgattcgctccgcgccgaggatgggcaacccctggctgacctcggcccgtcctgg
gtctggccaccctttcaacccgccgtgccgcgctggctggacgctctggcggtcgaatcg
tttgatcagtacgacgcgggcgatgccattctggatggcttcgaggacaccccgatccga
cagccgctgcccggacagtacggcatggcccgcctcgtcggtgggccgagcgccctcgtc
aaggcgatggccgctggtttatccgatggcgttgtgcaaacacagagcccggtgtcggcg
gtgcgtctgcaaaacgatggatcactgcgcattgaaggcgacaacggattggccctcagt
gctgatcgggtcatcctggcggtaccgcttcgtctggccgccgagcgcatcatcctgccc
gatgccttgccagatcgcctgcgcgaggagctaaagaaaacgccgacctggatggccgcg
caggccaaggctgtcgttcgttacgagcggcccttctggcgtgagcgtggcctatccggg
cgcattgcaagccgtcagggaccgctcttcgaagcccatgaccacaccagcgcccggggt
gatgccgcgcttttcggctttgtcggtaccccggtggggcatcgcgacccggcgttactc
gaacaggccatcctggctcagcttgagcgctgcctgggcccagagggtggccgacccgtc
gaattgcgggtcaaggactgggccaaggacgaatggatctgcagtgaggccgatcgcacc
ggcccgcaagcgcatcccaatgtcggctccgagcgcctccgcagcgggcatctggatcat
cgactctggttttgcgctgcagagaccgccgcacagagccccggactcatcgaaggcgcg
ctactcgccggcgaagccgccggtcacgcggctagcgcagggctgcggcgtgatgccgca
ggtgatcagcaataa

DBGET integrated database retrieval system