KEGG   Streptococcus suis BM407: SSUBM407_0367Help
Entry
SSUBM407_0367     CDS       T00935                                 

Gene name
gmk
Definition
(RefSeq) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
ssb  Streptococcus suis BM407
Pathway
ssb00230  Purine metabolism
ssb01100  Metabolic pathways
Module
ssb_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ssb00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SSUBM407_0367 (gmk)
Enzymes [BR:ssb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     SSUBM407_0367 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_22 AAA_16 RsgA_GTPase
Motif
Other DBs
NCBI-GeneID: 8154569
NCBI-ProteinID: YP_003028134
UniProt: A0A0H3MTH2
Position
406938..407564
Genome map
AA seq 208 aa AA seqDB search
MKERGLLIVFSGPSGVGKGTVRKEIFESSDNKFEYSVSMTTRPQRPGEVDGVDYFFRSRE
EFEDLIRQGQMLEYAEYVGNYYGTPLTYVNETLDKGIDVFLEIEVQGALQVKKKVPDGVF
IFLTPPDLEELQDRLIGRGTDSEEVIAQRIERAKEEIALMREYDYAVVNDEVPLAAERVK
RIIEAEHFRVDRVIGRYDEMIREQIVER
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagcgaggcttactcattgtcttttctggtccatctggtgttggaaaaggaaca
gttcgaaaggaaatttttgaaagctctgataataaatttgaatattctgtatccatgacg
acacgtccacagagaccgggagaagttgatggagttgactatttcttccgtagtcgtgag
gaatttgaagatttgattcgccagggtcaaatgttggaatatgcagagtacgttggaaat
tactatggaacacctctgacctatgtcaatgaaactcttgataagggaattgatgtcttt
ttagaaattgaagtacagggtgccctccaagtgaagaaaaaggttccagatggggtgttc
attttcttgacaccacctgacttggaggagttgcaagatcgcttgattggtcgcggaacg
gatagtgaggaagttattgctcaacgtatcgaacgtgccaaggaagagattgccttgatg
cgtgagtatgattatgcagttgtgaacgatgaagttccgttggctgctgagcgtgtcaag
cgtataatcgaagcagaacatttccgtgtagaccgagtgattggtcgctacgatgaaatg
attcgtgaacagatagtagaacgataa

DBGET integrated database retrieval system