KEGG   Streptococcus suis BM407: SSUBM407_0539Help
Entry
SSUBM407_0539     CDS       T00935                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ssb  Streptococcus suis BM407
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ssb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SSUBM407_0539 (tpiA)
   01230 Biosynthesis of amino acids
    SSUBM407_0539 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSUBM407_0539 (tpiA)
   00051 Fructose and mannose metabolism
    SSUBM407_0539 (tpiA)
   00562 Inositol phosphate metabolism
    SSUBM407_0539 (tpiA)
Enzymes [BR:ssb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SSUBM407_0539 (tpiA)
Exosome [BR:ssb04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SSUBM407_0539 (tpiA)
  Exosomal proteins of bladder cancer cells
   SSUBM407_0539 (tpiA)
  Exosomal proteins of melanoma cells
   SSUBM407_0539 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
595042..595794
Genome map
AA seq 250 aa AA seqDB search
MSRKPIIAGNWKMNKNPQEAQAFVEAIAGKLPAGDKIEAAIAAPAVDLNALLWFAKDSEL
KVAAQNCYFEDAGAFTGETSPKVLAEMGVNYVVIGHSERRDYFHETDEDINKKAHAIFRN
GLTPIICCGESLETYEAGKAVEFVGAQVSAALKDLTADQVASLVIAYEPIWAIGTGKSAT
KDDAQNMCKAVRDVVAADFGQEVADKVRVQYGGSVNPSNVAEYMACPDVDGALVGGASLE
AESFLALLNF
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaaccaatcattgccggtaactggaaaatgaacaaaaatcctcaagaagca
caagctttcgttgaggcaattgcaggaaaattgcctgcaggcgacaaaattgaagcagct
atcgcagctccagctgtagatttgaacgctctcttatggttcgctaaagattctgaattg
aaagttgctgctcaaaactgctactttgaagatgctggtgccttcactggtgaaacatct
ccaaaagtattggctgaaatgggtgttaactatgttgttatcggtcactcagagcgtcgt
gattacttccacgaaactgatgaagatattaataaaaaagctcatgcaatcttccgtaac
ggtttgactccaatcatctgttgtggtgagtcacttgaaacttacgaagctggtaaagca
gtagaatttgtaggtgctcaagtttctgcagctttgaaagacttgactgctgatcaagta
gcatcacttgttattgcttatgagccaatctgggcaatcggtactggtaaatcagctact
aaagatgatgcacaaaacatgtgtaaagctgttcgtgacgttgttgctgctgatttcggt
caagaagttgcagacaaagttcgcgttcaatacggtggttctgtaaacccatcaaacgtt
gctgaatacatggcatgtccagacgttgacggtgcgcttgttggtggtgcatcacttgaa
gcagaaagcttcttggctttgttgaacttctaa

DBGET integrated database retrieval system