KEGG   Streptococcus suis BM407: SSUBM407_0539Help
Entry
SSUBM407_0539     CDS       T00935                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ssb  Streptococcus suis BM407
Pathway
ssb00010  Glycolysis / Gluconeogenesis
ssb00051  Fructose and mannose metabolism
ssb00562  Inositol phosphate metabolism
ssb01100  Metabolic pathways
ssb01110  Biosynthesis of secondary metabolites
ssb01120  Microbial metabolism in diverse environments
ssb01130  Biosynthesis of antibiotics
ssb01200  Carbon metabolism
ssb01230  Biosynthesis of amino acids
Module
ssb_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ssb_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ssb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSUBM407_0539 (tpiA)
   00051 Fructose and mannose metabolism
    SSUBM407_0539 (tpiA)
   00562 Inositol phosphate metabolism
    SSUBM407_0539 (tpiA)
Enzymes [BR:ssb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SSUBM407_0539 (tpiA)
Exosome [BR:ssb04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SSUBM407_0539 (tpiA)
  Exosomal proteins of bladder cancer cells
   SSUBM407_0539 (tpiA)
  Exosomal proteins of melanoma cells
   SSUBM407_0539 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 8153684
NCBI-ProteinID: YP_003028302
UniProt: A0A0H3MTV5
Position
595042..595794
Genome map
AA seq 250 aa AA seqDB search
MSRKPIIAGNWKMNKNPQEAQAFVEAIAGKLPAGDKIEAAIAAPAVDLNALLWFAKDSEL
KVAAQNCYFEDAGAFTGETSPKVLAEMGVNYVVIGHSERRDYFHETDEDINKKAHAIFRN
GLTPIICCGESLETYEAGKAVEFVGAQVSAALKDLTADQVASLVIAYEPIWAIGTGKSAT
KDDAQNMCKAVRDVVAADFGQEVADKVRVQYGGSVNPSNVAEYMACPDVDGALVGGASLE
AESFLALLNF
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaaccaatcattgccggtaactggaaaatgaacaaaaatcctcaagaagca
caagctttcgttgaggcaattgcaggaaaattgcctgcaggcgacaaaattgaagcagct
atcgcagctccagctgtagatttgaacgctctcttatggttcgctaaagattctgaattg
aaagttgctgctcaaaactgctactttgaagatgctggtgccttcactggtgaaacatct
ccaaaagtattggctgaaatgggtgttaactatgttgttatcggtcactcagagcgtcgt
gattacttccacgaaactgatgaagatattaataaaaaagctcatgcaatcttccgtaac
ggtttgactccaatcatctgttgtggtgagtcacttgaaacttacgaagctggtaaagca
gtagaatttgtaggtgctcaagtttctgcagctttgaaagacttgactgctgatcaagta
gcatcacttgttattgcttatgagccaatctgggcaatcggtactggtaaatcagctact
aaagatgatgcacaaaacatgtgtaaagctgttcgtgacgttgttgctgctgatttcggt
caagaagttgcagacaaagttcgcgttcaatacggtggttctgtaaacccatcaaacgtt
gctgaatacatggcatgtccagacgttgacggtgcgcttgttggtggtgcatcacttgaa
gcagaaagcttcttggctttgttgaacttctaa

DBGET integrated database retrieval system