KEGG   Streptococcus suis BM407: SSUBM407_0572Help
Entry
SSUBM407_0572     CDS       T00935                                 

Definition
zinc-binding dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
ssb  Streptococcus suis BM407
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ssb00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SSUBM407_0572
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSUBM407_0572
  Lipid metabolism
   00071 Fatty acid degradation
    SSUBM407_0572
  Amino acid metabolism
   00350 Tyrosine metabolism
    SSUBM407_0572
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SSUBM407_0572
   00626 Naphthalene degradation
    SSUBM407_0572
Enzymes [BR:ssb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SSUBM407_0572
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(631564..632607)
Genome map
AA seq 347 aa AA seqDB search
MKAAIYEKAGKMTVAEIEKPSLQAKDDVIIKVVRACVCGSDLWGYGEDIHHDHGDTNSGH
EAIGIVEEVGEDITTLVPGDFVIVPFTHGCGHCDACRAGFDGTCDNHPGYTNWGNNYQSQ
YIRFHYGNWALVKIPGQPSDYSEGMIKSLLTLADVMPTGYHATRVADVKPGDKVVVIGDG
AVGQCAVIAAKMRGASQIIMMSRHADRQQMALESGATAVVAERGEEGIAKVREILGGGAD
AALECVGTEASIDQALGVLHNGGRIGFVGVPHYNNHALGSTFAQNIIIDGGSASVTTYDK
EILLDAVLKGDINPGRVFTQTYSLDNIDQAYKDMANRKTIKAMITVD
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagctatttatgaaaaagccggtaagatgaccgttgcagaaatcgaaaaacca
agccttcaagccaaagatgacgtcattatcaaggtcgttcgggcctgtgtctgtgggtcg
gacctttggggctacggagaagacattcaccatgaccacggtgacacaaactctggtcat
gaagccatcggtatcgttgaagaggtaggcgaagacattacaacacttgttcctggtgac
ttcgttatcgttccatttacacatggttgcggacactgtgatgcctgtcgtgctggcttt
gacggtacttgtgacaaccatccaggctacaccaactggggcaacaactaccagtctcaa
tatattcgtttccactacggtaactgggccttggtcaaaattcctggtcagccaagcgac
tactcagaaggcatgatcaaatctctcttgactctggcagatgttatgccaacaggctac
catgctacgcgtgttgcagatgtcaaacctggtgataaggtggttgtcatcggtgatggt
gcagtggggcaatgtgccgtcattgctgcaaaaatgcggggagcttcgcagattatcatg
atgagccgtcatgctgaccgtcagcaaatggctctggaatcaggggctactgctgttgtt
gctgaacggggcgaggaaggaattgccaaagtccgtgaaattcttggaggtggcgctgat
gctgccctcgaatgtgtcggaacagaagcttctattgaccaagccctcggcgtccttcat
aatggcggtcgcatcggttttgttggtgtgcctcattacaacaaccacgccctcggatca
acttttgctcaaaatatcattatcgatggtggctctgcttctgtcacaacctatgataag
gaaattttgcttgatgctgttctcaaaggcgacatcaacccaggtcgagttttcacccaa
acttacagcctggacaatatcgaccaagcctacaaagacatggccaaccggaaaacgatt
aaagctatgattacggtggattaa

DBGET integrated database retrieval system