KEGG   Streptococcus suis BM407: SSUBM407_0797Help
Entry
SSUBM407_0797     CDS       T00935                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
ssb  Streptococcus suis BM407
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ssb00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
874816..875379
Genome map
AA seq 187 aa AA seqDB search
MSKQEQIEQTIYQLLELLGEDPNREGLLDTPKRVAKMYLEMFNGLEEDPKDQFTAVFSEG
HEEVVLVKDIPFHSMCEHHLVPFYGIAHVAYIPSKGRVTGLSKLARAVEVASRRPQLQER
LTHQVAHALQDALEPEGVFVMVEAEHMCMSMRGIRKPGSKTVTTVALGKYKEDAILRREL
LSMIHNK
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaacaagaacaaatcgaacaaacaatttatcaattattggaattattgggtgag
gacccgaatcgtgaaggtttattagatacgcctaaacgggttgctaagatgtatttagaa
atgtttaacggcctagaagaggatcccaaagaccaatttacagctgtcttttcagaaggt
catgaagaggttgttttggtcaaggatattccttttcattctatgtgtgaacaccatttg
gtacccttttatggcattgcccatgtagcttatattccgagtaaggggcgtgtgacaggt
cttagcaaattggcgcgtgcagtggaggtagcaagtcgtcgccctcaattgcaggaacgc
ttgacccatcaggttgcccatgcccttcaagatgcccttgaaccagaaggtgtttttgtc
atggtcgaagcagagcacatgtgcatgagcatgcgtggtattcgcaagccaggtagtaag
acagtgaccacagttgctcttggcaaatacaaggaagatgccatcttgcgccgtgaactc
ttgtccatgattcacaataaatag

DBGET integrated database retrieval system