KEGG   Streptococcus suis BM407: SSUBM407_0798Help
Entry
SSUBM407_0798     CDS       T00935                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
ssb  Streptococcus suis BM407
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SSUBM407_0798 (folP)
Enzymes [BR:ssb01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     SSUBM407_0798 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
875388..876200
Genome map
AA seq 270 aa AA seqDB search
MSIEQLANQVTIMGILNVTPDSFSDGGHYNEVESALVQVEKLLAEGATVIDVGGESTRPG
ATFVSEEDEIARVVPIIRAIKENYDCLVSVDTYKTGTARAALEAGADILNDVWAGLYDGD
MLALAAEYKVPIILMHNQKDESYADVVGEVKNFLAERAQAALDAGVSADQIWLDPGFGFS
KNVQHNLDLLQGLEQITALGYPVLFGISRKRVVDYLLGGNSLPTDRDQATAALSAWAVQK
GCKMVRVHNVAANRDIVKVWDQLTSGGQHG
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatcgaacagttagcgaatcaagtaaccattatggggattctcaatgtgacgcca
gattcattttcagatggtggtcactataatgaggtggagtctgccttggtacaagtagaa
aagttgttggctgagggtgctaccgtcattgatgttggtggtgagtccactcggccaggt
gcaacatttgtgtctgaagaagacgagattgctcgcgtggttccgattatccgcgctatc
aaagaaaactatgactgtcttgtcagcgtcgatacctataaaacaggaactgcacgtgca
gccttggaagcaggcgcagatattttaaatgatgtctgggcaggactttatgatggagat
atgttggccctggctgcggagtacaaggtaccaattattctcatgcacaaccagaaagac
gaaagctatgcggatgttgttggagaggtcaaaaactttctagctgagcgtgcccaagca
gcacttgatgctggtgtttccgcagaccagatttggttggatccaggatttggcttttca
aagaatgtccaacataaccttgatctcttacaaggtttggaacagattactgcccttggt
tatcccgttctatttggaatatctcgtaagcgcgtggtggattatctgcttgggggcaat
agtttaccgactgaccgcgatcaagcaacggcagccttgtctgcctgggcagtccaaaaa
ggctgtaaaatggtccgtgttcacaatgtcgctgccaaccgtgatatcgttaaggtttgg
gaccaattgacttctggaggtcaacatggataa

DBGET integrated database retrieval system