KEGG   Streptococcus suis BM407: SSUBM407_0800Help
Entry
SSUBM407_0800     CDS       T00935                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
ssb  Streptococcus suis BM407
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SSUBM407_0800 (folK)
Enzymes [BR:ssb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     SSUBM407_0800 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
876552..877040
Genome map
AA seq 162 aa AA seqDB search
MKHLAYLSIGGNMGNRQAYLQAALDKLASHPGCQLGLVSNIYETPAWGKTDQADFLNLAC
QVYTDLSAQDFLSVFQNIEQELDRVRIEKWGQRTIDLDIIFWDEEKIQEENLIVPHPYAH
ERAFVLKPLAEIASDYCHPILKKVVSDLLAELGEQKDIKIFK
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgaagcatctagcctatctcagtatcggagggaatatgggcaatcgacaagcctattta
caggcagccctagacaaattagccagtcatccaggttgccagcttggcttagtttccaac
atttatgaaactccagcttggggcaagaccgaccaggctgatttcctcaatctagcctgt
caagtgtatactgatttgtctgctcaggattttctaagcgttttccagaacatcgaacaa
gagttggaccgagtacggattgaaaaatggggacaacggaccattgatttggatattatt
ttttgggatgaggagaagattcaagaagagaatctgattgttccccatccctacgcccat
gaaagagcatttgttctcaaacctcttgctgagattgcttctgattactgtcacccaatt
ttgaaaaaagtggtatcggacttgcttgcagaactaggggaacaaaaagatataaaaatt
ttcaaatag

DBGET integrated database retrieval system