KEGG   Streptococcus suis BM407: SSUBM407_0957Help
Entry
SSUBM407_0957     CDS       T00935                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
ssb  Streptococcus suis BM407
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SSUBM407_0957
   00670 One carbon pool by folate
    SSUBM407_0957
Enzymes [BR:ssb01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     SSUBM407_0957
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1037077..1037550)
Genome map
AA seq 157 aa AA seqDB search
MISLIVAVAKNNVIGNNGVIPWKIKGEQKRFKELTIGKTIIMGRKSFEEIGKPLPNRKTI
LISNTQCIESENCATVKSLSEAFDLTKDEDEVFVAGGGQVYKESFTYADRIYITVIDKII
DGNVYFPEISSDDFVKSYEERIEGEIPYTYYTYERRK
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgatttcattaatagttgccgtagcaaaaaataatgtaataggaaacaatggtgttata
ccatggaaaataaagggtgaacaaaaaaggtttaaagaattaacgataggtaaaacaata
atcatgggaagaaaatcttttgaagaaataggtaagccactacctaacagaaaaacaata
cttatttcaaatacgcaatgtattgaatcagagaattgtgcaactgtaaaatcgctttca
gaagcattcgatttaacaaaagatgaagacgaagtatttgttgctggtggtggacaggtg
tacaaggagtcatttacctatgcagatagaatatatattacagttatagataaaataatt
gatggcaatgtatattttccagagatttcttctgatgattttgtgaaatcctatgaagag
cgaattgagggggaaataccatacacatattatacgtatgaaagaagaaaataa

DBGET integrated database retrieval system