KEGG   Streptococcus suis BM407: SSUBM407_1097Help
Entry
SSUBM407_1097     CDS       T00935                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
ssb  Streptococcus suis BM407
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ssb00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ssb00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1179946..1180869)
Genome map
AA seq 307 aa AA seqDB search
MTITNGKVSLKHLVTMETLSNEEVLGLIQRGIAFKRGEKVELDRKYYASNLFFEDSTRTH
KSFEMAELRLDMGMIDFDARTSSVNKGETLCDTILTMSALGVDICVIRHSEVDYYKQLID
SPTIQTSIVNGGDGSGQHPSQSLLDLMTIYEEFGTFDGLKIAIAGDITHSRVAKSNMQIL
KRLGAEIFFAGPEEWYAEEFDVYGQHLNIDDIVETVDVLMLLRVQHERHDGDGGFSKETY
NRLHGLTEERYKRLKDTAIVMHPAPVNRDVEIDDSLVEAPKSRIVRQMQNGVFVRMAILE
AIVNGKA
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgacaattacaaatggtaaagtttcactcaaacacttggttacaatggagaccctctca
aatgaagaagtattgggactcattcaacgtggtattgcttttaaacgcggtgaaaaggta
gagttagatcggaagtactatgcttctaaccttttctttgaggattcaactcggacgcat
aagtcttttgaaatggcagagcttcgtttggatatgggaatgattgactttgatgctcgt
accagctcagtcaataagggtgaaaccttgtgtgataccattttgaccatgtcggcactt
ggggtagacatctgcgtgattcgtcactcggaagtggattattacaagcaattgattgat
agtcctaccattcagacttcaattgtcaatggtggtgatggttcaggtcaacacccaagc
caatccctacttgatttgatgactatttatgaagaatttggaacttttgacggcttgaag
attgccattgcaggtgatattacacactcacgggttgctaagtccaatatgcaaattttg
aagcgtctgggagctgagattttctttgctggaccggaggaatggtacgcagaggaattt
gacgtctatggtcagcatttgaatattgatgatattgtggaaacggtagatgtactgatg
ttgctccgtgtgcaacacgagcgtcatgatggtgatggtggtttttctaaagaaacttat
aaccgtttgcatggtttaacagaggagcgctacaaacgcttgaaagatactgcaattgtt
atgcatcctgcccctgttaaccgcgatgttgagattgatgattctctagttgaagcaccc
aaatcacgtattgtccgtcaaatgcagaatggtgtatttgtccggatggcgattttggaa
gcaattgtcaatggcaaggcttaa

DBGET integrated database retrieval system