KEGG   Streptococcus suis BM407: SSUBM407_1155Help
Entry
SSUBM407_1155     CDS       T00935                                 

Gene name
glpO
Definition
alpha-glycerophosphate oxidase (EC:1.1.3.21)
Orthology
K00105  
alpha-glycerophosphate oxidase [EC:1.1.3.21]
Organism
ssb  Streptococcus suis BM407
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:ssb00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1234601..1236430)
Genome map
AA seq 609 aa AA seqDB search
MEFSKETRRLAIERMQDRQLDLLIIGGGITGAGVALQAAASGMETALIEMQDFAEGTSSR
STKLVHGGLRYLKQFDVEVVSDTVSERAVVQNIAPHIPKPDPMLLPVYDEPGSTFSLFRL
KVAMDLYDLLAGVNNTDMANKVLTREEVLEREPNLKQEGLIGGGVYLDFRNNDARLVIEN
IKRAAKDGALIASRAKAEKFIKDDAGKVVGIVARDLLTDRTFEIRARLVINTTGPWSDEV
RNLGGEGSGVLQMRPTKGVHLVVDSSRLSVPQPTYFDTGHADGRMVFVLPRENKTYFGTT
DTDYTGDLANPMVTQEDVDYLLDIVNNRFPEANLTLDDIESGWAGLRPLLSGNGASDYNG
GNNGKLSDDSFNSLIETVKGYMNNEKTRDDVEHDLTHLEGSVSEKHLDPSAVSRGSALDR
DDNGLLTLAGGKITDFRKIAEGAIEKVADILKEEHGRSFKLINSKTYPVSGGELNPANVA
EEIEHLAQLGVKKGLLYDDALYLANLYGSNAPKVFVLNHKVEAVSGLNKRDLLSLHYAMK
EEMTLTAVDYLLRRTNYMLFMREQLDAVALEIIKEMVAYYAWSEEEVAQQKQLLADTLVK
NDLTYLKEK
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atggaattttcaaaagaaacaagacgcttagctattgagcgaatgcaggatcgtcaactt
gacctcctcattatcgggggtggtattacaggtgcaggtgtggctttgcaggcagcagca
agcggtatggaaacagccttgattgaaatgcaggactttgcagaaggaacttccagtcgc
tcaaccaaattggtccacggtggtcttcgctacctcaaacaatttgacgtggaagtggta
tccgataccgtatctgaacgtgctgtagtacaaaatatcgccccacatattccaaagcca
gacccaatgcttttaccagtctatgatgagccaggttctaccttcagcctcttccgtttg
aaagtggccatggacttgtatgatctcttggctggcgtcaataataccgatatggccaat
aaggtcttgacaagagaagaagtacttgaacgcgaaccaaacttgaagcaagaaggattg
attggtggcggtgtctatcttgatttccgcaacaatgatgctcgtttggttattgaaaat
atcaaacgtgcagccaaggatggtgccttgattgccagccgtgccaaagctgagaaattc
atcaaagatgatgctggaaaagttgtcggtatcgtcgctcgtgatttgctgacagaccgc
acctttgaaatccgtgcgcgtttggtcatcaatacaacaggaccatggagtgatgaagtg
cgtaatctgggtggagaaggttcaggcgttctccagatgcgtccgaccaagggtgtgcac
ctagttgtcgatagctctcgcttgtctgtaccacagccgacttactttgatactggccat
gcggatggtcgaatggtctttgtccttccgcgtgaaaataaaacctattttggtacgact
gatacagactatactggtgatttggcaaatccaatggtaacccaagaagatgttgactac
ctgcttgatattgtcaacaatcgcttcccagaagcaaacttgaccctggatgacattgag
agtggttgggcaggtcttcgtcccctcttgtctggaaatggtgcttctgactacaatggt
ggaaacaacggtaagctcagcgatgacagctttaatagcttgattgaaacggtcaaaggt
tatatgaacaatgaaaagacacgtgacgatgtggaacatgatttgacccatctggaaggc
agcgtttctgaaaaacacttggatccttcagctgtatcacgtggctctgcccttgaccgt
gatgacaatggtttgctgactcttgctggtggtaagattactgacttccgtaagatagcg
gaaggtgcaattgaaaaagtggcagacattctcaaagaagaacatggtcgcagcttcaaa
ctcatcaattctaagacctatccagtctctggtggtgaattgaaccctgcaaacgtagca
gaagaaattgaacatcttgctcaactaggtgtgaagaaaggtctcctttatgatgacgcc
ctttacttggcaaacttgtacggttcaaatgctccaaaagtctttgtattaaaccataaa
gtagaagccgtttctggcttgaacaagcgtgatttgctttcccttcactatgctatgaag
gaagagatgaccttgactgcagttgactatcttcttcgtcgtaccaactacatgctcttt
atgcgtgagcagttggatgcagttgcgcttgaaatcattaaggaaatggtagcttattat
gcttggtcagaggaagaagttgctcaacagaaacaattgttggcagatacacttgttaag
aatgatttgacctatttgaaagaaaaatag

DBGET integrated database retrieval system