KEGG   Sus scrofa (pig): 100037300Help
Entry
100037300         CDS       T01009                                 

Gene name
XIAP, BIRC4
Definition
X-linked inhibitor of apoptosis
Orthology
K04725  
E3 ubiquitin-protein ligase XIAP
Organism
ssc  Sus scrofa (pig)
Pathway
NF-kappa B signaling pathway
Ubiquitin mediated proteolysis
Apoptosis
Focal adhesion
Toxoplasmosis
HTLV-I infection
Pathways in cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100037300 (XIAP)
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    100037300 (XIAP)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    100037300 (XIAP)
  Cell communication
   04510 Focal adhesion
    100037300 (XIAP)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100037300 (XIAP)
   05222 Small cell lung cancer
    100037300 (XIAP)
  Infectious diseases
   05166 HTLV-I infection
    100037300 (XIAP)
   05145 Toxoplasmosis
    100037300 (XIAP)
Mitochondrial biogenesis [BR:ssc03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Retention of mitochondria
    100037300 (XIAP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
X
AA seq 496 aa AA seqDB search
MTFNSFEGSKSCVPTDINKDEEFVEEFNRLKTFANFPSSSPVSASTLARAGFLYTGEGDT
VRCFSCHAAVDRWQYGDSAVGRHRKVSPNCRFINGFYLENSAVQPTNPGVQNGQYKAENY
LGNRNHFVLERPSETHADYLLRTGQVVDLSDTIYPRNPAMCSEEARLKSFQNWPDYAHLT
PRELASAGLYYTGIDDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNVNIRSE
SDVSSDRNFPNSTNLPRNPAMADYEARIITFGTWIYSVNKEQLARAGFYALGEGDKVKCF
HCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEEKGQEYINSIHLTHSIEESLVRSAEKTPS
LTKRIDDTIFQNPMVQEAIRMGFSFKDIKKIMEEKIETSGSNYKSLEVLVADLVSAQKDN
AQDESSQTSLQKEISAEEQLRLLQEEKLCKICMDRNIAVVFIPCGHLVTCKQCAEAIDKC
PMCNTVITFKQKIFMS
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgacttttaacagttttgaaggatctaaatcttgtgtacctacagacatcaataaggat
gaagaatttgtagaagagtttaatagactaaaaacttttgctaattttccaagtagtagt
cctgtttcagcatcaacgctagcacgagctggttttctatatactggtgaaggagacaca
gtgcggtgctttagttgtcatgcggcagtagatagatggcaatatggagactcagcagtt
ggaagacacaggaaagtatccccaaattgcagatttatcaatggcttttatttggaaaat
agtgctgtgcaacctacaaatcctggtgtccaaaatggtcagtacaaagctgaaaactat
ctgggaaacagaaatcattttgttttagaaaggccatctgagactcatgcagactatctt
ttgagaactggacaggttgtagacttatcagacaccatatacccgaggaaccctgccatg
tgtagtgaagaagctagattaaagtcgtttcagaactggccagactatgctcacttaacc
cctagagagttagctagtgctggactctactacacaggtattgatgatcaggtgcagtgc
ttttgttgtggcgggaaactgaaaaattgggaaccatgtgatcgtgcatggtcagaacac
aggcggcactttcctaattgcttttttgttttgggccggaatgttaatattcgaagtgaa
tctgatgtgagttctgataggaatttcccaaattcgacaaatcttccaagaaatccagcc
atggcagattatgaagcacggatcattacatttgggacgtggatatattcagttaacaag
gagcagcttgcaagagctggattttatgctttaggtgaaggtgataaagtaaagtgcttt
cactgtggaggagggctaacagattggaagcccagtgaagacccttgggaacaacatgct
aagtggtatccagggtgtaaatatctgttagaagagaagggacaagaatatataaacagt
attcatttaacacattcaattgaggagtctctggtgagaagtgctgaaaaaacaccatca
ttaactaaaagaattgatgataccatattccagaatcctatggtacaagaagctatacga
atgggattcagtttcaaggacattaagaaaataatggaggaaaagattgagacatctgga
agcaactataaatcacttgaggttctggttgcagatttagtgagtgctcagaaagacaat
gcacaagatgaatcaagtcagacttcattacagaaagaaattagtgctgaagaacagctg
aggctcctgcaagaggagaagctttgcaaaatctgtatggatagaaatattgctgtggtt
tttattccttgtggacatctggtcacttgtaaacagtgtgctgaagcaattgacaaatgt
ccgatgtgcaacacagtcattactttcaagcaaaaaatttttatgtcttag

DBGET integrated database retrieval system