KEGG   Sus scrofa (pig): 100037966Help
Entry
100037966         CDS       T01009                                 

Gene name
SOCS2
Definition
suppressor of cytokine signaling 2
Orthology
K04695  
suppressor of cytokine signaling 2
Organism
ssc  Sus scrofa (pig)
Pathway
Jak-STAT signaling pathway
Insulin signaling pathway
Prolactin signaling pathway
Type II diabetes mellitus
Module
ECS complex
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    100037966 (SOCS2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100037966 (SOCS2)
   04917 Prolactin signaling pathway
    100037966 (SOCS2)
 Human Diseases
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    100037966 (SOCS2)
Ubiquitin system [BR:ssc04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   ECS complex
    target recognizing subunit (SOCS box)
     100037966 (SOCS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
5
AA seq 198 aa AA seqDB search
MTLRCLEPSGNGAEGTQSQWGTSGSAEEPSPEAARLAKALRELSHTGWYWGSMTVNEAKE
KLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFD
SVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPPLQHLCRLTINKCTGTIWG
LPLPTRLKDYLEEYKFQV
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgcggtgcctcgagccctccgggaatggcgcggaagggacgcagagccagtgg
gggacctcggggtcggcggaggagccgtccccagaggcggcgcgactggcgaaagccctg
cgggagcttagtcacacaggttggtactggggaagtatgactgttaatgaagccaaagag
aaattaaaagaggcacccgaaggaactttcttgattagagatagttcgcactcagactac
ctactaacaatatctgttaaaacatcagctggaccaactaatctgcgcatcgaataccaa
gacgggaaattcagattggactctatcatatgtgtcaagtccaagcttaagcaatttgac
agtgtggttcatctgatcgactactatgttcagatgtgcaaggataagcggacgggccca
gaagccccccggaacggcaccgttcacctctatctgaccaaaccgctctacacatcagca
ccacccctgcagcatctctgtagactcaccattaacaaatgtaccggtactatctgggga
ctgcctttaccaacaagactaaaagattacttggaagaatataaattccaggtgtaa

DBGET integrated database retrieval system