KEGG   Sus scrofa (pig): 100037966Help
Entry
100037966         CDS       T01009                                 

Gene name
SOCS2
Definition
suppressor of cytokine signaling 2
Orthology
K04695  
suppressor of cytokine signaling 2
Organism
ssc  Sus scrofa (pig)
Pathway
Jak-STAT signaling pathway
Insulin signaling pathway
Prolactin signaling pathway
Type II diabetes mellitus
Module
ECS complex
Class
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:ssc04630]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:ssc04910]
Organismal Systems; Endocrine system; Prolactin signaling pathway [PATH:ssc04917]
Human Diseases; Endocrine and metabolic diseases; Type II diabetes mellitus [PATH:ssc04930]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
5
AA seq 198 aa AA seqDB search
MTLRCLEPSGNGAEGTQSQWGTSGSAEEPSPEAARLAKALRELSHTGWYWGSMTVNEAKE
KLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFD
SVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPPLQHLCRLTINKCTGTIWG
LPLPTRLKDYLEEYKFQV
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgcggtgcctcgagccctccgggaatggcgcggaagggacgcagagccagtgg
gggacctcggggtcggcggaggagccgtccccagaggcggcgcgactggcgaaagccctg
cgggagcttagtcacacaggttggtactggggaagtatgactgttaatgaagccaaagag
aaattaaaagaggcacccgaaggaactttcttgattagagatagttcgcactcagactac
ctactaacaatatctgttaaaacatcagctggaccaactaatctgcgcatcgaataccaa
gacgggaaattcagattggactctatcatatgtgtcaagtccaagcttaagcaatttgac
agtgtggttcatctgatcgactactatgttcagatgtgcaaggataagcggacgggccca
gaagccccccggaacggcaccgttcacctctatctgaccaaaccgctctacacatcagca
ccacccctgcagcatctctgtagactcaccattaacaaatgtaccggtactatctgggga
ctgcctttaccaacaagactaaaagattacttggaagaatataaattccaggtgtaa

DBGET integrated database retrieval system