KEGG   Sus scrofa (pig): 100038019Help
Entry
100038019         CDS       T01009                                 

Definition
(RefSeq) TGF-beta receptor type-2
  KO
K04388  
TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
ssc  Sus scrofa (pig)
Pathway
MAPK signaling pathway
Cytokine-cytokine receptor interaction
FoxO signaling pathway
Endocytosis
TGF-beta signaling pathway
Osteoclast differentiation
Hippo signaling pathway
Adherens junction
AGE-RAGE signaling pathway in diabetic complications
Chagas disease (American trypanosomiasis)
HTLV-I infection
Pathways in cancer
Transcriptional misregulation in cancer
Colorectal cancer
Pancreatic cancer
Chronic myeloid leukemia
Module
TGF-beta signaling
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100038019
   04350 TGF-beta signaling pathway
    100038019
   04390 Hippo signaling pathway
    100038019
   04068 FoxO signaling pathway
    100038019
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100038019
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100038019
  Cellular community - eukaryotes
   04520 Adherens junction
    100038019
 Organismal Systems
  Development
   04380 Osteoclast differentiation
    100038019
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100038019
   05202 Transcriptional misregulation in cancers
    100038019
   05210 Colorectal cancer
    100038019
   05212 Pancreatic cancer
    100038019
   05220 Chronic myeloid leukemia
    100038019
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100038019
  Infectious diseases
   05166 HTLV-I infection
    100038019
   05142 Chagas disease (American trypanosomiasis)
    100038019
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     100038019
Protein kinases [BR:ssc01001]
 Serine/threonine protein kinases: TKL group
  TGFBR2 family [OT]
   100038019
Enzyme-linked receptors [BR:ssc01020]
 Receptor serine/threonine kinases
  Type II TGF-beta receptor
   100038019
Cytokine receptors [BR:ssc04050]
 TGF-beta receptors
  Type II TGF-beta receptor
   100038019
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
13
AA seq 410 aa AA seqDB search
MSSGDRHWLWSWRRNTWSLPVWCSQPASDGEVGKEIGIQKEYKSPHAFHKSYADGKTYAV
RGVDPLPSTVHPLNQLLLSCVSTAEYATNNPDLLLVIFQVTGVSLLPPLGIAIAVIITFY
CYRVHRQQKLSPSWDSGKPRKLMEFSEHLAIILEDDRSDISSTCANNINHNTELLPIELD
TLVGKGRFAEVYKAKLRQNTSEQFETVAVKIFPYEEYASWKTEKDIFSDINLKHENILQF
LTAEERKTELGKQYWLITAFHAKGNLQEYLTRHVISWEDLRRLGGSLARGIAHLHSDHTL
CGRPKMPIVHRDLKSSNILVKGDLTCCLCDFGLSLRLDPTLSVDDLANSGQVGTARYMAP
EVLESRMNLENVESFKQTDVYSMALVLWEMTSRCNAVGGRHGPPPWHPGT
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgtccagtggagacaggcactggttatggtcctggaggagaaatacatggtccctgcca
gtgtggtgctctcagccggccagtgatggggaagtagggaaagagataggaatccaaaaa
gaatacaagtcaccacatgctttccataaaagctatgcagatggtaaaacctatgctgtc
cgaggtgtggacccacttccctccactgtgcacccactgaaccaactccttctctcctgt
gtttccactgcagagtatgccaccaacaaccccgacttgctgttagtcatcttccaagtg
acaggtgtcagcctcctgccaccactaggcattgccatcgccgtcatcatcaccttctac
tgctaccgtgtccaccggcagcagaagctgagcccatcctgggactcagggaagccacgg
aagctgatggagttcagtgagcacctggccatcatcctggaggatgaccgctccgacatc
agctccacctgtgccaacaacatcaaccacaacacggaactgctgcccatcgagctggac
accctggtgggcaaagggcgctttgccgaggtctataaggccaagctgaggcagaacaca
tctgagcagttcgagaccgtggctgtcaagatcttcccctatgaggagtatgcctcctgg
aagacagagaaggacatcttctcggacatcaacctcaagcacgagaacatcctgcagttc
ctgacagctgaggaacgcaagacagagctgggcaagcagtactggctgatcactgccttc
cacgccaagggcaacctgcaggagtatctgacgcgccacgtcatcagctgggaggacctc
cgcaggctgggcggctcgctggcccgtggcattgcacacctgcacagcgaccacaccctg
tgcggccggcccaagatgcccatcgtgcacagggacctcaagagctccaacatcctggtc
aaaggtgacctcacctgctgcctctgtgacttcggcctctccctgcggctggaccccact
ctgtcagtggatgacttggccaacagtgggcaggtgggaactgcaagatacatggctcct
gaagtcctagagtccaggatgaatttggagaatgttgagtccttcaagcagacggatgtc
tactccatggctctggtgctctgggagatgacgtctcgctgcaacgcggtgggaggtagg
catggaccaccgccatggcaccctggtacctga

DBGET integrated database retrieval system