KEGG   Sus scrofa (pig): 100038019Help
Entry
100038019         CDS       T01009                                 

Gene name
TGFBR2
Definition
(RefSeq) TGF-beta receptor type-2
  KO
K04388  
TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
ssc  Sus scrofa (pig)
Pathway
MAPK signaling pathway
Cytokine-cytokine receptor interaction
FoxO signaling pathway
Endocytosis
Cellular senescence
TGF-beta signaling pathway
Osteoclast differentiation
Hippo signaling pathway
Adherens junction
Th17 cell differentiation
AGE-RAGE signaling pathway in diabetic complications
Chagas disease (American trypanosomiasis)
HTLV-I infection
Pathways in cancer
Transcriptional misregulation in cancer
Colorectal cancer
Pancreatic cancer
Chronic myeloid leukemia
Module
TGF-beta signaling
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100038019 (TGFBR2)
   04350 TGF-beta signaling pathway
    100038019 (TGFBR2)
   04390 Hippo signaling pathway
    100038019 (TGFBR2)
   04068 FoxO signaling pathway
    100038019 (TGFBR2)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100038019 (TGFBR2)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100038019 (TGFBR2)
  Cell growth and death
   04218 Cellular senescence
    100038019 (TGFBR2)
  Cellular community - eukaryotes
   04520 Adherens junction
    100038019 (TGFBR2)
 Organismal Systems
  Immune system
   04659 Th17 cell differentiation
    100038019 (TGFBR2)
  Development
   04380 Osteoclast differentiation
    100038019 (TGFBR2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100038019 (TGFBR2)
   05202 Transcriptional misregulation in cancers
    100038019 (TGFBR2)
   05210 Colorectal cancer
    100038019 (TGFBR2)
   05212 Pancreatic cancer
    100038019 (TGFBR2)
   05220 Chronic myeloid leukemia
    100038019 (TGFBR2)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100038019 (TGFBR2)
  Infectious diseases
   05166 HTLV-I infection
    100038019 (TGFBR2)
   05142 Chagas disease (American trypanosomiasis)
    100038019 (TGFBR2)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     100038019 (TGFBR2)
Protein kinases [BR:ssc01001]
 Serine/threonine protein kinases: TKL group
  TGFBR2 family [OT]
   100038019 (TGFBR2)
Enzyme-linked receptors [BR:ssc01020]
 Receptor serine/threonine kinases
  Type II TGF-beta receptor
   100038019 (TGFBR2)
Cytokine receptors [BR:ssc04050]
 TGF-beta receptors
  Type II TGF-beta receptor
   100038019 (TGFBR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
13
AA seq 567 aa AA seqDB search
MGRGLLGGLWPLHVVLWTRIASTIPPHVPKSVNSDMMVTDSNGAVKLPQLCKFCDVRSST
CDNQKSCLSNCSITAICEKPQEVCVAVWRKNDENITIETVCHDPKIAYHGFVLDDAASSK
CIMKERKGSGETFFMCSCSSDECNDHIIFSEEYATNNPDLLLVIFQVTGVSLLPPLGIAI
AVIITFYCYRVHRQQKLSPSWDSGKPRKLMEFSEHLAIILEDDRSDISSTCANNINHNTE
LLPIELDTLVGKGRFAEVYKAKLRQNTSEQFETVAVKIFPYEEYASWKTEKDIFSDINLK
HENILQFLTAEERKTELGKQYWLITAFHAKGNLQEYLTRHVISWEDLRRLGGSLARGIAH
LHSDHTLCGRPKMPIVHRDLKSSNILVKGDLTCCLCDFGLSLRLDPTLSVDDLANSGQVG
TARYMAPEVLESRMNLENVESFKQTDVYSMALVLWEMTSRCNAVGEVKDYEPPFGSKVRE
HPCVESMKDNVLRDRGRPEIPSSWLNHQGIQTVCETLAECWDHDPEARLTAQCVAERFSE
LEHLDRLSGRSSSEEKIPEHGSLNTTK
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgggccgggggctgctcgggggcctgtggccgctgcacgtcgtcctgtggacgcgcatc
gccagcacgatcccgccgcacgttcccaagtcggttaatagcgacatgatggtcactgac
agcaatggtgccgtcaagcttccacaactgtgtaaattctgtgatgtgcgatcatccacc
tgtgacaaccagaagtcctgcctgagcaactgcagcatcacagccatctgtgagaagcca
caggaggtctgcgtggctgtctggaggaagaatgacgagaacatcacaattgagacagtt
tgtcacgaccccaagatcgcctaccacggatttgttctcgatgacgccgcttcttcaaaa
tgtattatgaaggagaggaaagggtctggagagacgttctttatgtgctcctgcagctca
gacgagtgcaacgaccacatcatcttctcagaagagtatgccaccaacaaccccgacttg
ctgttagtcatcttccaagtgacaggtgtcagcctcctgccaccactaggcatcgccatc
gccgtcatcatcaccttctactgctaccgtgtccaccggcagcagaagctgagcccatcc
tgggactcagggaagccgcggaagctgatggagttcagtgagcacctggccatcatcctg
gaggatgaccgctccgacatcagctccacctgtgccaacaacatcaaccacaacacggaa
ctgctgcccatcgagctggacaccctggtgggcaaagggcgctttgccgaggtctataag
gccaagctgaggcagaacacatctgagcagttcgagaccgtggctgtcaagatcttcccc
tatgaggagtatgcctcctggaagacagagaaggacatcttctcggacatcaacctcaag
cacgagaacatcctgcagttcctgacagctgaggaacgcaagacagagctgggcaagcag
tactggctgatcactgccttccacgccaagggcaacctgcaggagtatctgacgcgccac
gtcatcagctgggaggacctccgcaggctgggcggctcgctggcccgtggcattgcacac
ctgcacagcgaccacaccctgtgcggccggcccaagatgcccatcgtgcacagggacctc
aagagctccaacatcctggtcaaaggtgacctcacctgctgcctctgtgacttcggcctc
tccctgcggctggaccccactctgtcagtggatgacttggccaacagtgggcaggtggga
actgcaagatacatggctcctgaagtcctagagtccaggatgaatttggagaatgttgag
tccttcaagcagacggatgtctactccatggctctggtgctctgggagatgacgtctcgc
tgcaacgcggtgggagaggtgaaggactatgagccaccctttggttccaaggtgcgggag
catccctgtgttgaaagcatgaaggacaacgtgttgagagaccgaggacggccagaaatt
cctagctcctggctcaaccaccagggcatccagacagtgtgtgagacactggccgagtgc
tgggaccatgaccccgaggcccggctcactgcgcagtgcgtggcagagcgcttcagcgag
ctggagcatctggacagactctcggggaggagcagctcggaagagaagattcctgaacat
ggctccctgaacactaccaaatag

DBGET integrated database retrieval system