KEGG   Sus scrofa (pig): 100125839Help
Entry
100125839         CDS       T01009                                 

Gene name
RAE1
Definition
(RefSeq) mRNA export factor
  KO
K14298  mRNA export factor
Organism
ssc  Sus scrofa (pig)
Pathway
ssc03013  RNA transport
ssc05164  Influenza A
Module
ssc_M00427  Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100125839 (RAE1)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    100125839 (RAE1)
Messenger RNA biogenesis [BR:ssc03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     100125839 (RAE1)
Chromosome and associated proteins [BR:ssc03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    100125839 (RAE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 Nup160
Motif
Other DBs
NCBI-GeneID: 100125839
NCBI-ProteinID: NP_001098766
Ensembl: ENSSSCG00000007503
Vega: OTTSUSG00000000591
UniProt: A5GFN6
Position
17
AA seq 368 aa AA seqDB search
MSLFGTTSGFGTSGTSMFGSTTTDNHNPMKDIEVTSSPDDSIGCLSFSPPTLPGNFLIAG
SWANDVRCWEVQDSGQTIPKAQQMHTGPVLDVCWSDDGSKVFTASCDKTAKMWDLNSNQA
IQIAQHDAPVKTIHWIKAPNYSCVMTGSWDKTLKFWDTRSSNPMMVLQLPERCYCADVIY
PMAVVATAERGLIVYQLENQPSEFRRIESPLKHQHRCVAIFKDKQNKPTGFALGSIEGRV
AIHYINPPNPAKDNFTFKCHRSNGTNTSAPQDIYAVNGIAFHPVHGTLATVGSDGRFSFW
DKDARTKLKTSEQLDQPISACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAE
ELKPRNKK
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgtttggaacaacctcgggttttggaaccagtgggactagcatgtttggcagc
acaaccacagataatcacaaccctatgaaggatattgaagtaacatcctctcctgacgat
agcattggttgtctatcttttagcccacccaccttgccggggaactttctcattgcagga
tcgtgggctaacgatgttcgctgttgggaagttcaggatagtggacagactattccaaaa
gctcagcagatgcacactgggcccgtgcttgatgtctgctggagtgatgatgggagcaaa
gtatttacagcatcatgtgataaaactgccaaaatgtgggacctcaacagtaaccaggcg
atacagattgcacagcatgatgctcctgttaaaaccatacattggatcaaagcaccaaac
tacagctgtgtgatgacggggagctgggataagacgttgaagttttgggatacacggtca
tcaaatcctatgatggttttgcagctccctgaaaggtgttactgtgctgacgtgatatac
cctatggccgtggtggcaactgcagagaggggcctgattgtctatcagctggagaatcag
ccctctgaattcaggaggatagaatcgccgctgaaacaccagcatcggtgtgtggccatt
tttaaagacaaacagaacaagccgaccggtttcgccctggggagcatcgaggggagagtc
gccattcactacatcaaccctccgaaccccgccaaagataacttcaccttcaagtgtcat
cgctctaacgggaccaacacgtccgctccgcaggacatctacgcggtaaacgggatcgca
ttccatcctgttcacggcacccttgcaaccgtggggtctgatggtagattcagcttctgg
gacaaagatgccagaacaaaactcaaaacttcggagcagttagaccagccaatatcggct
tgctgcttcaatcacaacggaaacatatttgcctacgcttccagctacgactggtcaaag
ggacatgaattttataatccccagaagaaaaattacattttcctgcgtaacgcagctgag
gagctaaaaccccggaataagaaatag

DBGET integrated database retrieval system