KEGG   Sus scrofa (pig): 100125839Help
Entry
100125839         CDS       T01009                                 

Gene name
RAE1, MRNP41
Definition
RAE1 RNA export 1 homolog (S. pombe)
Orthology
K14298  
mRNA export factor
Organism
ssc  Sus scrofa (pig)
Pathway
RNA transport
Influenza A
Class
Genetic Information Processing; Translation; RNA transport [PATH:ssc03013]
Human Diseases; Infectious diseases; Influenza A [PATH:ssc05164]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Vega: 
UniProt: 
Position
17
AA seq 368 aa AA seqDB search
MSLFGTTSGFGTSGTSMFGSTTTDNHNPMKDIEVTSSPDDSIGCLSFSPPTLPGNFLIAG
SWANDVRCWEVQDSGQTIPKAQQMHTGPVLDVCWSDDGSKVFTASCDKTAKMWDLNSNQA
IQIAQHDAPVKTIHWIKAPNYSCVMTGSWDKTLKFWDTRSSNPMMVLQLPERCYCADVIY
PMAVVATAERGLIVYQLENQPSEFRRIESPLKHQHRCVAIFKDKQNKPTGFALGSIEGRV
AIHYINPPNPAKDNFTFKCHRSNGTNTSAPQDIYAVNGIAFHPVHGTLATVGSDGRFSFW
DKDARTKLKTSEQLDQPISACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAE
ELKPRNKK
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgtttggaacaacctcgggttttggaaccagtgggactagcatgtttggcagc
acaaccacagataatcacaaccctatgaaggatattgaagtaacatcctctcctgacgat
agcattggttgtctatcttttagcccacccaccttgccggggaactttctcattgcagga
tcgtgggctaacgatgttcgctgttgggaagttcaggatagtggacagactattccaaaa
gctcagcagatgcacactgggcccgtgcttgatgtctgctggagtgatgatgggagcaaa
gtatttacagcatcatgtgataaaactgccaaaatgtgggacctcaacagtaaccaggcg
atacagattgcacagcatgatgctcctgttaaaaccatacattggatcaaagcaccaaac
tacagctgtgtgatgacggggagctgggataagacgttgaagttttgggatacacggtca
tcaaatcctatgatggttttgcagctccctgaaaggtgttactgtgctgacgtgatatac
cctatggccgtggtggcaactgcagagaggggcctgattgtctatcagctggagaatcag
ccctctgaattcaggaggatagaatcgccgctgaaacaccagcatcggtgtgtggccatt
tttaaagacaaacagaacaagccgaccggtttcgccctggggagcatcgaggggagagtc
gccattcactacatcaaccctccgaaccccgccaaagataacttcaccttcaagtgtcat
cgctctaacgggaccaacacgtccgctccgcaggacatctacgcggtaaacgggatcgca
ttccatcctgttcacggcacccttgcaaccgtggggtctgatggtagattcagcttctgg
gacaaagatgccagaacaaaactcaaaacttcggagcagttagaccagccaatatcggct
tgctgcttcaatcacaacggaaacatatttgcctacgcttccagctacgactggtcaaag
ggacatgaattttataatccccagaagaaaaattacattttcctgcgtaacgcagctgag
gagctaaaaccccggaataagaaatag

DBGET integrated database retrieval system