KEGG   Sus scrofa (pig): 100126274Help
Entry
100126274         CDS       T01009                                 

Gene name
SIRT6
Definition
sirtuin 6
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
ssc  Sus scrofa (pig)
Pathway
Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    100126274 (SIRT6)
Enzymes [BR:ssc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     100126274 (SIRT6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 328 aa AA seqDB search
MSVNYAAGLSPYADKGKCGLPEVFDPPEELEQKVWELAQLVWQSSNVVFHTGAGISTASG
IPDFRGPHGVWTMEERGLAPKFDTTFENARPTKTHMALVQLERVGLLRFLVSQNVDGLHV
RSGFPRDKLAELHGNMFVEECVKCKTQYVRDTVVGSMGLKATGRLCTVAKSRGLRACRVE
LRDTILDWEDALPDRDLTLADEASRNADLSITLGTSLQIRPSGNLPLTTKRRGGRLVIVN
LQPTKHDRHADLRIHGYVDEVMTRLMKHLGLEIPAWDGPRVLELTLLLVSALVGRPQDSE
SWAPGPHYTSLSLGPLEGAWQGASLPWA
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtgaattatgcggctggcctgtcgccgtacgcagacaagggcaagtgcggtctc
cccgaggtgtttgacccccctgaggaattggagcagaaggtatgggagctggcacagctg
gtctggcagtcctccaacgtggtgttccacacgggcgcgggcatcagcaccgcctcaggc
atccctgacttcaggggtccccatggtgtctggacaatggaggagcgaggcctggccccc
aagttcgacaccaccttcgagaacgcgaggcccacgaagacccacatggcactggtgcag
ctggagcgcgtgggcctcctccgcttcctggtcagccagaacgtggatgggctgcatgtg
cgatccggcttccccagggacaagctggcagagcttcatggaaacatgttcgtagaagaa
tgtgtcaagtgtaagacgcaatacgtccgggacaccgtggtggggagcatgggcctgaag
gctaccggccgcctctgcaccgtggccaagtcaagggggctacgggcctgcagggtggag
ctgagagacaccatcctagactgggaggatgccctgcctgaccgagacctcaccctcgct
gacgaggccagcaggaacgccgacctgtccatcacgctgggcacctccctgcaaatccgg
cccagcgggaacctgccgctcaccaccaaacgccgggggggccggctggtcattgtcaac
cttcagcccaccaagcacgaccgccatgcagacctgcgtatccacggctacgtagatgag
gtcatgacccggctcatgaagcacctgggcctggagatcccggcctgggacggcccccgt
gtcctagagctcactttattactcgtctctgcccttgtggggagacctcaggactctgag
agctgggctccaggcccacattacacctcccttagcttggggcctctggagggggcctgg
caaggggcatccctgccctgggcctaa

DBGET integrated database retrieval system