KEGG   Sus scrofa (pig): 100126281Help
Entry
100126281         CDS       T01009                                 

Gene name
CYP3A46, CYP3A88
Definition
cytochrome P450 3A46
Orthology
K07424  
cytochrome P450, family 3, subfamily A [EC:1.14.14.1]
Organism
ssc  Sus scrofa (pig)
Pathway
Steroid hormone biosynthesis
Linoleic acid metabolism
Retinol metabolism
Metabolic pathways
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100126281 (CYP3A46)
   00591 Linoleic acid metabolism
    100126281 (CYP3A46)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100126281 (CYP3A46)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100126281 (CYP3A46)
Enzymes [BR:ssc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100126281 (CYP3A46)
Cytochrome P450 [BR:ssc00199]
 Cytochrome P450, animal type
  CYP3 family
   100126281 (CYP3A46)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 503 aa AA seqDB search
MDLIPGFSTETWVLLATSLVLLYLYGTYSHGLFKKLGIPGPRPLPYFGNILGYRKGVDHF
DKKCFQQYGKMWGFFDGRQPVLAITDPDMIKTVLVKECYSVFTNRRSFGPRGAMRSAVSL
AEDEEWKRIRTLLSPTFTSGKLKEMFPIISHYGDLLVSNLRKEAEKGKPVTMKDIFGAYS
MDVITSTAFGVNVDSLNNPQDPFVENSRKLLKFSFFSPFFLSIIFFPFLTPILEVLNITL
FPKSVVNFFTRSIKRMKESRLKDTQKHRVDLLQLMINSQNSKEMDAHKGLSNEELVAQGV
IFIFAGYETTSSSLSLLVYELATHPDVQQKLQEEIDATFPNKAPPTYDGLAQMEYLDMVV
NESLRIFPVTPRLERSCKKDVEIHGVFVPKGTVMMVPIFALHRAPELWPEPEEFRPERFS
KKNKDTINPYTYLPFGTGPRNCIGMRFALMNMKLALVRVLQNFSFKPCRETQIPLKISSQ
GLIQPEKPIVLMVVPRDGTTSGA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggacctgatcccaggcttttccacagaaacctgggttctcctggctaccagcctggtg
ctcctctatctatatgggacttattcacatggcctttttaagaagctggggattcctggg
ccaagacctctgccttattttggaaatatcctgggctaccgtaagggtgttgaccatttt
gacaaaaagtgttttcaacagtatgggaaaatgtgggggttttttgatggtcggcagccc
gtgttggctatcaccgatccagacatgatcaaaacggtcctcgtgaaagaatgttattct
gtcttcacaaaccggcggtcttttggtccacgtggtgctatgagaagtgctgtctctctg
gctgaggatgaagagtggaaaagaatccgaacgttgctgtctccgaccttcaccagtgga
aagctcaaggagatgttccccatcattagccattatggagacttgttggtgagcaacctg
aggaaggaagcagagaaaggcaaacctgtgaccatgaaagacatctttggggcctacagc
atggacgtgatcactagcacagcatttggagtgaacgtcgattccctcaacaacccacaa
gacccctttgtggaaaacagcaggaagctcttaaaatttagtttcttcagtccattcttt
ctctcaataatattctttccattcttgaccccgatcttggaagtattaaacatcactctg
tttcccaaaagtgttgtgaattttttcacgagatccataaaaaggatgaaagaaagtcgc
ctcaaagatacacaaaagcaccgagtggaccttcttcagctgatgattaactcccagaat
tccaaagaaatggacgcccataaaggtctgtccaatgaagaacttgtggcccaaggtgtt
atttttatttttgctgggtatgagaccactagcagttctctctccctccttgtgtatgaa
ttggccactcaccctgacgtccagcagaagctgcaggaggagattgatgcgaccttcccc
aataaggcgcctcccacctacgatggtctggcgcaaatggagtatcttgacatggtggtg
aacgaatctctcagaatattcccagttactcctagacttgagaggtcctgtaagaaggat
gtggaaatccatggcgtgttcgttcccaaagggaccgtgatgatggtgccaatctttgcg
cttcacagagccccggagctctggccagagcctgaggagttccgccctgaaaggttcagt
aagaagaacaaggacaccataaatccttacacttacctgccctttgggactggaccccgc
aactgcattggcatgaggtttgccctcatgaacatgaaactcgctctcgtcagagtcctg
cagaacttctccttcaaaccttgtagagaaacacagatccccctgaaaataagctcccag
ggacttatccaaccagaaaaacctattgttctaatggttgtgcccagagatgggaccaca
agtggagcctga

DBGET integrated database retrieval system