KEGG   Sus scrofa (pig): 100127484Help
Entry
100127484         CDS       T01009                                 

Gene name
MOS, c-mos, p39-mos
Definition
v-mos Moloney murine sarcoma viral oncogene homolog (EC:2.7.11.1)
Orthology
K04367  
proto-oncogene serine/threonine-protein kinase mos [EC:2.7.11.1]
Organism
ssc  Sus scrofa (pig)
Pathway
MAPK signaling pathway
Oocyte meiosis
Regulation of actin cytoskeleton
Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100127484 (MOS)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100127484 (MOS)
  Cell growth and death
   04114 Oocyte meiosis
    100127484 (MOS)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100127484 (MOS)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100127484 (MOS)
Protein kinases [BR:ssc01001]
 Serine/threonine protein kinases: Other group
  MOS family
   100127484 (MOS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
4
AA seq 345 aa AA seqDB search
MPSPFPRRRCLPGDFSPSVDSRPCSSPCELPGPTGKLFLGGTPPRALRLPRRLAWCSIDW
EQVCLLQRLGAGGFGSVYKATYHGVPVAIKQVSRCTKNRLASQRSFWAELNIARLRHANI
VRVVAASTRTPAAFDSLGSIIMEFGGNVTLHQVIYGATGCPEEDGPPCSAGEQLNLEKCL
KYSLDVVSGLLFLHSQGIVHLDLKPANILISEQDVCKISDFGCSERLEDLRFRPRHHLGG
TYTHRAPELLKGEPVTPKADIYSFAITLWQMTTRQVPYSGERQHVLYAVVAYNLRPSLSA
AVFTESVPGKKLEDIIQCGWTAPAQQRPSAQLLLLDLRALQAELG
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgccctcacctttccctcggcgccggtgcctgcctggcgacttctccccgtcggtggac
tcgcggccctgcagcagcccctgcgagctcccggggccgacagggaagctcttcctgggg
ggcaccccaccccgggccctgcgccttcctcgccggctggcctggtgctcaatagactgg
gaacaggtgtgcctgctgcagcggctgggagccgggggcttcggctcggtatacaaggcc
acctaccacggcgtgcctgtggccatcaaacaggtgagcagatgcaccaagaaccggctg
gcatcccagcgcagtttctgggccgagctcaacatcgctcggctccgccacgccaatatc
gtgcgcgtggtggccgccagcacgcgcacacccgcggcctttgacagcctgggcagcatc
atcatggagttcggcggcaacgtcaccttacaccaggtcatctacggcgctacgggctgt
ccagaggaggatgggcctccctgcagtgctggggagcaactgaacttggagaagtgtctc
aagtattccctggatgtggtcagtggcctgcttttcctgcactcccaaggcattgtgcac
ttggacctgaagccagcgaacattctgatcagtgagcaggacgtctgcaaaatcagcgac
tttggttgctccgagaggctggaagatctgcgcttccggcctcggcaccacctgggcggc
acgtacacccaccgagcccccgagctcctcaaaggcgagcccgtcaccccaaaagcggac
atctactcctttgccatcaccctctggcagatgaccactaggcaggtgccttactcaggg
gagcgtcagcacgtgctctacgcggtggtggcctacaatctccgtccgtccctctcggcg
gcggtcttcaccgagtccgtccctgggaagaaactggaggacatcatccagtgcggctgg
acggcccctgcgcagcagcggcccagcgcacaactcctcctgctggaccttcgcgctcta
caagctgaactgggctga

DBGET integrated database retrieval system