KEGG   Sus scrofa (pig): 100127484Help
Entry
100127484         CDS       T01009                                 

Gene name
MOS, c-mos, p39-mos
Definition
v-mos Moloney murine sarcoma viral oncogene homolog (EC:2.7.11.1)
Orthology
K04367  
proto-oncogene serine/threonine-protein kinase mos [EC:2.7.11.1]
Organism
ssc  Sus scrofa (pig)
Pathway
MAPK signaling pathway
Oocyte meiosis
Regulation of actin cytoskeleton
Progesterone-mediated oocyte maturation
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:ssc04010]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:ssc04810]
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:ssc04114]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:ssc04914]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
4
AA seq 345 aa AA seqDB search
MPSPFPRRRCLPGDFSPSVDSRPCSSPCELPGPTGKLFLGGTPPRALRLPRRLAWCSIDW
EQVCLLQRLGAGGFGSVYKATYHGVPVAIKQVSRCTKNRLASQRSFWAELNIARLRHANI
VRVVAASTRTPAAFDSLGSIIMEFGGNVTLHQVIYGATGCPEEDGPPCSAGEQLNLEKCL
KYSLDVVSGLLFLHSQGIVHLDLKPANILISEQDVCKISDFGCSERLEDLRFRPRHHLGG
TYTHRAPELLKGEPVTPKADIYSFAITLWQMTTRQVPYSGERQHVLYAVVAYNLRPSLSA
AVFTESVPGKKLEDIIQCGWTAPAQQRPSAQLLLLDLRALQAELG
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgccctcacctttccctcggcgccggtgcctgcctggcgacttctccccgtcggtggac
tcgcggccctgcagcagcccctgcgagctcccggggccgacagggaagctcttcctgggg
ggcaccccaccccgggccctgcgccttcctcgccggctggcctggtgctcaatagactgg
gaacaggtgtgcctgctgcagcggctgggagccgggggcttcggctcggtatacaaggcc
acctaccacggcgtgcctgtggccatcaaacaggtgagcagatgcaccaagaaccggctg
gcatcccagcgcagtttctgggccgagctcaacatcgctcggctccgccacgccaatatc
gtgcgcgtggtggccgccagcacgcgcacacccgcggcctttgacagcctgggcagcatc
atcatggagttcggcggcaacgtcaccttacaccaggtcatctacggcgctacgggctgt
ccagaggaggatgggcctccctgcagtgctggggagcaactgaacttggagaagtgtctc
aagtattccctggatgtggtcagtggcctgcttttcctgcactcccaaggcattgtgcac
ttggacctgaagccagcgaacattctgatcagtgagcaggacgtctgcaaaatcagcgac
tttggttgctccgagaggctggaagatctgcgcttccggcctcggcaccacctgggcggc
acgtacacccaccgagcccccgagctcctcaaaggcgagcccgtcaccccaaaagcggac
atctactcctttgccatcaccctctggcagatgaccactaggcaggtgccttactcaggg
gagcgtcagcacgtgctctacgcggtggtggcctacaatctccgtccgtccctctcggcg
gcggtcttcaccgagtccgtccctgggaagaaactggaggacatcatccagtgcggctgg
acggcccctgcgcagcagcggcccagcgcacaactcctcctgctggaccttcgcgctcta
caagctgaactgggctga

DBGET integrated database retrieval system