KEGG   Sus scrofa (pig): 100134959Help
Entry
100134959         CDS       T01009                                 

Gene name
G6PC
Definition
glucose-6-phosphatase, catalytic subunit (EC:3.1.3.9)
Orthology
K01084  
glucose-6-phosphatase [EC:3.1.3.9]
Organism
ssc  Sus scrofa (pig)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
FoxO signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100134959 (G6PC)
   00052 Galactose metabolism
    100134959 (G6PC)
   00500 Starch and sucrose metabolism
    100134959 (G6PC)
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100134959 (G6PC)
   04151 PI3K-Akt signaling pathway
    100134959 (G6PC)
   04152 AMPK signaling pathway
    100134959 (G6PC)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100134959 (G6PC)
   04920 Adipocytokine signaling pathway
    100134959 (G6PC)
  Digestive system
   04973 Carbohydrate digestion and absorption
    100134959 (G6PC)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     100134959 (G6PC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 357 aa AA seqDB search
MEEGMNLLHNFGIQSTRYLQVNYQDSQDWFILVSVIADLRNAFYVLFPIWFHLQEAVGIK
LLWVAVIGDWLNLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGLA
MGTAGVYYVMVTSALSIIRGKKKPTYGFRCLNVILWLGFWTVQLNVCLSRIYLAAHFPHQ
VVAGVLSGIAVAETFRHIQSIYNASLKKYFLITFFLFSFAIGFYLLLKGLGVDLSWTLEK
AKRRCERPEWVHIDTTPFASLLKNVGTLFGLGLALNSSMYRQGCKGKLSKWFPFRLSCIV
ASLVLLHFFDSLKPPSQIELIFYVLSFCKSAAVPLASVSLIPYCLSRALGQPDKKTL
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggaggagggaatgaaccttctccataactttgggatccaatcaacgcgctacctccag
gtgaattaccaggactcccaggattggttcatcttggtatctgtgatcgcggacctcaga
aatgccttttatgtcctcttccccatctggttccatcttcaagaagctgtgggcatcaaa
ctcctctgggtagctgtgattggagactggctcaacctcgtctttaagtggattctcttt
ggacagcgcccctactggtgggtcctggacactgactactacagcaacacctcggtgcca
ctgataaagcagttcccagtcacctgtgagactggcccagggagtccctctggccttgcc
atgggcacagcaggtgtatactatgtgatggtcacatccgccctctctatcattcgggga
aagaaaaagccaacctacggctttcggtgcttgaatgtcattttgtggttgggattctgg
actgtgcagctgaacgtctgtctgtcacgaatctaccttgctgctcatttcccccatcaa
gttgttgctggagtcttgtcaggcattgcagttgctgagactttccgccacattcagagt
atctacaacgccagcctcaagaagtattttctcattaccttcttcctgttcagttttgcc
attggattttacctgctgctaaaggggctgggcgttgacctctcgtggaccctagagaaa
gccaagcgaaggtgtgagcggccagaatgggtccacatcgacaccacgccctttgccagc
ctcctcaagaacgtggggaccctcttcggcctgggtctggctctcaactccagcatgtac
aggcagggctgcaaaggcaagctcagcaagtggttcccgttccgcctcagctgcatcgtg
gcctccctcgtcctcctgcacttctttgactccttgaaacccccatcccaaatcgagctg
atcttctacgtcctgtccttctgcaagagcgcggcagtgcccctggcatctgtcagcctc
atcccctactgcctctcccgggccctgggccagcccgacaagaagactttgtag

  All links  
No link information was found.   
DBGET integrated database retrieval system