KEGG   Sus scrofa (pig): 100135659Help
Entry
100135659         CDS       T01009                                 

Gene name
NCOA3, SRC3
Definition
nuclear receptor coactivator 3 (EC:2.3.1.48)
Orthology
K11256  
nuclear receptor coactivator 3 [EC:2.3.1.48]
Organism
ssc  Sus scrofa (pig)
Pathway
Thyroid hormone signaling pathway
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100135659 (NCOA3)
Enzymes [BR:ssc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100135659 (NCOA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
17
AA seq 1390 aa AA seqDB search
MMSGLGENSLDPLAPDSRKRKLPCDTPGQGLTCSGEKWRREQESKYIEELAELISANLSD
IDNFNVKPDKCAILKETVRQIRQIKEQGQGVIDKDSLGPLLLQALDGFLFVVNREGNIVF
VSENVTQYLQYKQEDLVNTSVYSILHEEDRKDFLKNLPKSTVNGVTWTNETQRQKSHTFN
CRMLMKIPHDILEDMNTSPEMRQRYETMQCFALSQPRAMMEEGEDLQSCMICVARRITTG
ERAFPSNPESFITRHDLSGKVVSIDTNSLRSSMRPGFEDIIRRCIQRFFSLNDGQSWSQK
RHYQEAYIHGHAETPVYRFSLADGTIVTAQTKSKLFRNPVTNDRHSFVSTHFLQREQNGY
RPNPNPVGQGVRPPAAGCNSSVGSMNMSPNQGLQMLSSRTYGLADPSTTGQMTGARYGAA
GSIASMNPGPGMQSPSSYQNSNYGLNMSSPPHGSPGLGSNQQNIMISPRNRGSPKMASHQ
FSPVAGVHSPMGSSGSTGNHSFSSSSLSALQAISEGVGTSLLSTLSSPGPKLDNSPNMNI
TQPSKVSSQDSKSPLGLYCDQNPVESSMCQSNSRDHLNDKESKESSVEGSENQRGPLESK
GHKKLLQLLTCSSDDRGHSSLTNSPLDSGCKDSAISVTSPSGVSSSTSGGVSSTSNMHGS
LLQEKHRILHKLLQNGNSPAEVAKITAEATGKDTSSTASCVEGNVKQEQLSPKKKENNAL
LRYLLDRDDPSDTLSKELQPKVEGVDGKMSQCSSSALPSSSQEKDSKIKTETNEEGSGDL
DNLDAILGDLTSSDFYNNSISTNGSNLGTKQQMFQGTNSLGLRSPQSVQSVRPPYNRAVS
LDSPVSVGSNPSVKNISAFPMLTKQPLMGGNPRMMDGQENYGSAMGGPNRNVAVNQTPSS
GDWGLPNSKASRMEPMNPNSMGRPGTDFNASLPRPAVGGSMPTMPLRSNSIPGARPVLQQ
QQQQQQQMLQMRPGEIPVGMGVGPYGQGAPSNQPGSWPDGMLSMEQGPHGTQNRPLLRNS
LDDLLGPPSNLEGQSDERALLDQLHTLLSNTDATGLEEIDRALGIPELVNQGQALEPKQD
AFQGQEAAVMMEQKAALYGQTYPAQGPPMQGGFNLQGQSPSFNSMMNQMNQQGNFPLQGM
HPRANIMRPRTNTPKQLRMQLQQRLQGQQFLNQNRQALEMKMESPSAGGAAVMRPMMQPQ
VSSQGFLITHMVAHRSRKLLINHFRQQRVAMMMQQQQQQQQQTQAFSPPPNVTASPSMDG
VLAGPSMPQAPPQQFPYPPNYGMGQQPDPAFGRVSSPSNAMMSSRMGPSQNPMMQHPQTA
PMYQSSDMKGWPSGTLARNSSFPQQQFAPQGNPAAYSMVHMNGSSGPMGQMNMNSVPMTG
MPMGPDQKYC
NT seq 4173 nt NT seq  +upstreamnt  +downstreamnt
atgatgagtggattaggagaaaactcgttggatccactagcccctgattcacgaaaacgc
aagttgccctgtgatactccgggacaaggccttacctgcagtggtgaaaagtggagacgg
gagcaggagagtaaatatattgaagaactggctgaactgatatctgctaatcttagcgat
attgacaatttcaacgtcaaaccagataaatgtgcaattttaaaggaaacagtaaggcag
atacgtcaaataaaagagcaaggacaaggggtgattgataaagactccttaggaccactt
ttacttcaggcgttggatggtttcctgtttgtggtgaatcgagaaggaaacattgtattt
gtgtcagaaaacgtcactcagtacctgcaatacaagcaagaagacctggttaacacaagt
gtctacagtatcttgcatgaagaagacagaaaggatttccttaaaaacttaccgaaatct
acagttaatggagttacctggacaaatgagacccagagacaaaaaagccatacatttaat
tgccgtatgttgatgaagataccacatgatatcctggaagacatgaacactagtcctgaa
atgcgccagagatatgaaacgatgcagtgctttgccctgtcccagcctcgagctatgatg
gaggagggggaagatttgcaatcctgcatgatctgtgtggcccgccgaatcactactgga
gaaagagcgtttccatcaaaccctgagagctttattactagacatgatctttcaggaaaa
gttgttagtatagatacaaattcactgagatcctccatgaggcctggctttgaagatata
atccgaaggtgtatccagagattttttagtcttaatgatgggcagtcatggtcccagaaa
cgtcactatcaagaagcttatatccatggccatgcagaaaccccagtgtatcgattctct
ttggctgatggcactatagtgactgcacagacaaagagcaaactctttcgaaatcctgta
acaaatgatcgtcacagctttgtctccacccactttcttcagagggaacagaatgggtat
agaccaaacccaaatcctgttggacaaggcgttaggcctccagcagctggatgcaacagt
tcagtaggcagcatgaacatgtcgccaaaccaaggcttacagatgctgagcagcaggacc
tatggcttggctgaccccagcaccacaggccagatgactggagctaggtatggggctgct
ggtagcatagcttcgatgaaccctggaccaggcatgcagtcaccatcttcctaccagaac
agcaactacggtctcaacatgagtagccctccgcacgggagtcctggtcttggctccaac
cagcagaatatcatgatttctcctcgtaatcgtgggagcccaaagatggcctcacatcag
ttttctcccgttgcaggtgtgcactctcccatgggatcttctggcagtactgggaatcac
agcttttctagcagctctctcagtgcccttcaagctatcagtgagggtgtggggacttct
cttttatctactctgtcttcaccaggtcccaaactggataactctcccaatatgaacata
acccaaccaagtaaagtgagcagtcaggattccaagagtcccctaggcttgtattgtgac
cagaatccagtggagagttccatgtgtcagtccaatagcagggatcacctcaatgacaag
gaaagtaaggagagcagtgtggaaggctcagagaatcaaaggggtcctctggagagcaaa
ggtcacaaaaagttactgcagttacttacctgttcctccgatgaccggggccattcctcc
ttgaccaactccccgctggattcaggatgtaaagactcggccattagcgtcaccagcccc
tctggggtctcttcttcaacctctggaggagtgtcctccacatccaatatgcatgggtca
ctgctgcaagagaagcaccggattttgcacaagttgctgcagaatgggaactcgccggcc
gaagtagccaagattactgccgaagccactgggaaagacactagtagcacagcatcttgt
gtggaaggaaacgtcaagcaggagcaactaagtcctaagaagaaggaaaataacgctctg
cttaggtatctgctggacagggatgatcctagtgacacactctccaaagaactgcagccc
aaagtagaaggcgtggacggtaaaatgagccagtgcagcagttcagcccttcctagctca
agtcaagagaaagactctaaaattaagacagaaacgaatgaagagggatctggagacttg
gataatctagatgctattcttggtgatctaactagttctgatttttataataattccata
tctacaaatggtagtaatcttggaaccaagcagcagatgtttcaaggaactaattctctg
ggtttgaggagtccgcagtctgtgcagtctgttcgtcctccatataaccgagcagtgtct
ctagatagccccgtttctgttggctcaaatccttcagtaaagaatatcagtgctttcccc
atgttaacaaagcagcccctgatgggtggcaatccaagaatgatggatggtcaggaaaat
tatggctcagctatgggtggacccaacagaaacgtggctgtgaatcagactccttcctca
ggagactggggcttacctaactcaaaggccagccgaatggagcctatgaatccaaactcg
atgggaagaccaggaacggattttaacgcctctctgcccagacctgcagtgggtggctcc
atgcccaccatgcctcttcggtccaatagcatcccaggtgcgagaccagtgttgcagcag
cagcaacagcagcagcagcagatgcttcaaatgcggcctggtgagattcccgtgggaatg
ggggtcggtccttatggccaaggagcaccatcgaaccaacctggttcctggccagatggc
atgttgtctatggaacaaggccctcatgggactcaaaataggccacttcttaggaactcc
ctggatgatctccttggaccaccttctaacctggaaggccagagtgatgaaagagcattg
ttggaccagctgcacacactcttgagcaatacagatgccacaggcttggaagaaattgac
agagctctgggcattcctgaacttgtaaatcaaggacaagctttggagcccaaacaggat
gctttccaaggccaagaagcggcagtaatgatggagcagaaggcagcattgtatgggcag
acatatccagcacaggggcctccaatgcaaggaggctttaatcttcagggacaatcacca
tcatttaactctatgatgaatcagatgaaccagcaaggcaattttcctctccaaggaatg
caccccagagccaacatcatgagacccaggacaaacacccccaagcagcttagaatgcag
cttcagcaaaggctgcagggccagcagtttttgaatcagaaccgccaagcacttgagatg
aaaatggaaagccccagtgctggtggggctgcggtgatgaggcccatgatgcagccgcag
gtcagctcccagggtttccttattacccacatggttgcccaccgcagcagaaaattgctg
attaatcacttccggcagcagagggtggcgatgatgatgcaacagcagcagcagcagcag
cagcagacgcaggccttcagtccaccccctaacgtgactgcctcccccagcatggacggg
gtcttggccgggccttcaatgccccaagctccgccccagcagtttccgtatcctccaaat
tacgggatgggacaacaaccagatccagcctttggtcgagtgtctagcccttccaatgcg
atgatgtcatcaagaatgggtccctcccagaaccccatgatgcagcaccctcagaccgca
cccatgtaccagtcctcggacatgaagggctggccctcaggaaccctggccaggaacagc
tcctttccacagcagcagtttgccccccaggggaaccctgcagcgtacagtatggtgcac
atgaatggcagcagtggtcccatgggacagatgaacatgaactccgtgcccatgaccggc
atgcccatgggtcctgatcagaaatattgctga

DBGET integrated database retrieval system