KEGG   Sus scrofa (pig): 100135661Help
Entry
100135661         CDS       T01009                                 

Gene name
SCD5
Definition
stearoyl-CoA desaturase 5 (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
ssc  Sus scrofa (pig)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
PPAR signaling pathway
Class
Metabolism; Overview; Fatty acid metabolism [PATH:ssc01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:ssc01040]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:ssc03320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
8
AA seq 332 aa AA seqDB search
MPGPAADGGKAPFRSAREDVRAGVGAEGAEGGGSRERPGERRPRQDIVWRNVVLMSLLHL
GAVYSLLLIPKAQPLTLLWAYFCFLLTALGVTAGAHRLWSHRSYKAKLPLRIFLAVANSM
AFQNDIFEWSRDHRVHHKYSETDADPHNARRGFFFSHIGWLFVRKHRDVIEKGRKLDVTD
LLADPVVRFQRKYYKISVVLMCFVVPTLVPWGVWGESLWNSYFLASILRYTVSLNVTWLV
NSAAHMYGNRPYDRHISPRQNPLVTLGAIGEGFHNYHHTFPFDYSASELGLNFNPTTWFI
DFMCWLGLATDRKRATKLMIEARKARTGDGSA
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgccaggcccggccgccgacggggggaaggcccccttccgcagcgccagggaggacgtc
cgcgccggggtcggggccgagggtgcggagggcggcggcagccgggagaggcccggcgag
cggcggccgcggcaggacatcgtctggaggaacgtcgtgctgatgagcctgctccacttg
ggggccgtgtactccctgctgctcatccccaaagcccagccgctcacgctgctctgggcc
tacttctgcttcctcctgaccgctctgggtgtgacagcgggcgcccatcgcttgtggagc
cacaggtcctacaaggccaagctgcctctgaggatatttctggctgtcgccaactccatg
gctttccagaacgacatcttcgagtggtccagggaccaccgcgtccaccacaagtactcg
gagacggacgctgacccccacaacgcccggcgcggcttcttcttctctcacatcgggtgg
ctgtttgtccgcaagcaccgggatgtcatcgagaaggggaggaagctggacgttaccgac
ctgctggctgaccctgtggtccggttccagagaaagtactataagatctccgtggtgctc
atgtgcttcgtggtccccacgctggtgccctggggcgtctggggggagagcctgtggaat
tcctacttcctggcctccatcctccgctacaccgtctcactcaacgtcacctggctggtc
aacagtgccgcccacatgtacggaaaccggccctacgacaggcacatcagcccccggcag
aacccgctcgtcaccctgggtgccatcggtgaaggcttccacaactaccatcacaccttt
cccttcgactactctgcgagtgaattgggcttaaatttcaacccgaccacctggttcatt
gacttcatgtgctggctggggctggccactgaccgcaaacgggccaccaagctgatgatc
gaggcccggaaggccaggactggagacggcagtgcctga

DBGET integrated database retrieval system