KEGG   Sus scrofa (pig): 100141310Help
Entry
100141310         CDS       T01009                                 

Gene name
PBK
Definition
PDZ binding kinase (EC:2.7.11.1)
Orthology
K08865  
PDZ-binding kinase [EC:2.7.12.2]
Organism
ssc  Sus scrofa (pig)
Brite
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100141310 (PBK)
Protein kinases [BR:ssc01001]
 Serine/threonine protein kinases: Other group
  TOPK family
   100141310 (PBK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
14
AA seq 322 aa AA seqDB search
MEESSNFKTPSKLSEKKKPALCLTPCINIPASPFMQKLGYGTGVNVYLMKRSPRGLSHSP
WAVKKINPRCNDYYQSMYQKRLTDEAKILKSLNHPNIIGYRAFTEASDGSLCLAMEYGGE
KSLNDLIEERNKDSQDPFPAAIILKVALNMARGLKYLHQEKKLLHGDIKSSNVVIKGDFE
TIKICDVGVSLPLDENMTVTDPEAYYIGTEPWKPKEALEENGIITDKADIFAFGLTLWEM
MTLSIPHISLPDDDDEDKTFDESDFDDEAYYAALGTRPPINMEELDATYQKVIELFSVCT
NEDPKDRPSAAHIVAALEMDVL
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaagcagtaatttcaagacaccaagcaagttatccgaaaaaaagaaacctgca
ttgtgtttaactccatgtataaacattcctgcctctccgtttatgcagaagcttggctat
ggtactggagtaaatgtctaccttatgaaaagatctccaagaggtttgtctcattctcct
tgggctgtgaaaaagattaatcctagatgtaatgattattatcagagtatgtatcaaaag
agactgactgatgaagctaagattttgaaaagccttaatcatccaaatattataggttac
cgtgcttttactgaagccagcgatggtagtctgtgtcttgctatggaatatggaggtgaa
aagtctctgaatgacttaatagaagaacgaaataaagatagccaagatccttttccagca
gccataattttaaaagttgcgttgaacatggcaagagggttaaagtatctgcaccaagaa
aagaaactgcttcatggagatataaagtcttcaaatgttgttattaaaggtgattttgaa
acaattaaaatctgtgatgtaggagtctctctaccattggatgaaaatatgactgtgact
gacccagaggcctattacatcggcactgagccttggaaacctaaggaagctctagaggaa
aatggtattattactgacaaggcagacatatttgcctttggccttactctgtgggaaatg
atgactttatctattccacacattagtcttccagatgatgatgatgaagataagactttt
gatgaaagtgactttgatgatgaagcatactatgcagccttgggaactcggccacctatt
aatatggaagaattggatgcaacgtaccagaaggtaattgagctcttctctgtatgcacc
aatgaagaccctaaggatcgcccttctgctgcgcacattgttgccgctttggaaatggat
gtcctgtga

DBGET integrated database retrieval system