KEGG   Sus scrofa (pig): 100144458Help
Entry
100144458         CDS       T01009                                 

Gene name
GTF2H4, TFIIH
Definition
general transcription factor IIH, polypeptide 4, 52kDa
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
ssc  Sus scrofa (pig)
Pathway
Basal transcription factors
Nucleotide excision repair
Viral carcinogenesis
Module
Holo-TFIIH complex
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:ssc03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:ssc03420]
Human Diseases; Cancers; Viral carcinogenesis [PATH:ssc05203]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Vega: 
UniProt: 
Position
7
AA seq 463 aa AA seqDB search
MESTPSRGGLNRVHLQCRNLQEFLGGLSPVVLDRLYGHPATCLAVFRELPSLAKNWVMRM
LFLEQPLPQAAVALWVKKEFSKAQEESTGLLSGLRIWHTQLLPGGLQGLILNPIFRQNLR
IALLGGGKAWSDDTSQLGPDKHARDVPSLDKYAEERWEVVLHFMVGSPSAAVSQDLAQLL
SQAGLMKSAEPGEPPCITSAGFQFLLLDTPAQLWYFMLQYLQTAQSRGMDLVEILSFLFQ
LSFSTLGKDYSVEGMSDSLLNFLQHLRELGLVFQRKRKSRRYYPTRLAINLSSGVSGAGG
TVHQPGFIVVETNYRLYAYTESELQIALIALFSEMLYRFPNMVVAQVTRESVQQAIASGI
TAQQIIHFLRTRAHPVMLKQTPVLPPTITDQIRLWELERDRLRFTEGVLYNQFLSQVDFE
LLLAHARELGVLVFENSAKRLMVVTPAGHSDVKRFWKRQKHSS
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggagagcaccccttcaaggggtggactgaatcgagtacacctacaatgcaggaatctg
caggaattcttagggggcctgagccctgttgtattggaccgattgtatgggcaccctgcc
acctgtttggctgtcttcagggagctcccatctttagctaagaactgggtgatgcggatg
ctctttctggagcagcctctgccacaagctgccgtagccttgtgggtgaagaaggaattc
agcaaagcccaggaggaaagcacggggctgctgagcggcctccgtatctggcacacccag
ctgctccctggtggcctccagggcctcatcctcaaccccatcttccgccaaaacctccgc
attgcccttctgggtgggggcaaggcctggtctgatgacacaagtcagctgggaccagac
aagcatgcccgggatgtgccctcgcttgacaagtatgctgaggagcgatgggaggtggtc
ctgcacttcatggtgggctcccccagtgcagccgtcagccaggacttggctcagctcctc
agccaggctgggctcatgaagagtgctgaacctggagagccgccttgcattacctctgcg
ggcttccaattcctgttgttggacaccccggcccagctctggtactttatgttgcagtac
ctgcagacagcccagagtcggggcatggacctagtggagattctctccttcctcttccag
ctcagcttctctactctgggcaaggattactctgtggaaggtatgagtgattctctgttg
aacttcctgcaacatctccgtgagttgggccttgttttccagaggaagaggaagtctcgg
cgttactaccccacgcgcctggccatcaatctctcatcaggtgtttctggggctgggggc
actgtgcatcagccaggtttcatcgttgtggaaaccaattatcgactgtacgcctacacg
gagtcggagctgcagatcgcccttattgcccttttctctgagatgctctatcgcttcccc
aacatggtggtggcacaggtgacccgggagagtgtgcagcaggccattgccagtggcatc
acagcccaacagatcatccatttcctaaggacaagggcccacccagtgatgcttaaacag
acacctgtgctgcctcccaccatcacagaccagattcggttgtgggagctagaaagggac
agactacggttcactgaaggcgtcctctataaccagttcctgtcacaagtggactttgag
ctgctgctggcccacgcgcgggagctgggcgtcctagtgttcgagaactcggcaaagcgg
ctcatggtggtgaccccggcgggacacagcgacgtcaagcgcttctggaagcggcagaag
cacagctcttga

DBGET integrated database retrieval system