KEGG   Sus scrofa (pig): 100144465Help
Entry
100144465         CDS       T01009                                 

Gene name
MRPS18B
Definition
mitochondrial ribosomal protein S18B
Orthology
K16174  
small subunit ribosomal protein S18b, mitochondrial
Organism
ssc  Sus scrofa (pig)
Pathway
Viral carcinogenesis
Class
Human Diseases; Cancers; Viral carcinogenesis [PATH:ssc05203]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 258 aa AA seqDB search
MAASILNVLLRRLPGVSPFRGAYGVQVLLQTLCTKAPPEDDSLPQVPISPYKDEPWKYLD
SEEYQNRYGSRPVWADYRRNHKGGIPPQRTRKMCIRGNKVAGNPCPICRDQKLHVDFRNV
KLLEQFVCAHTGIIFHAPYTGVCMKQHKKLTQAIQKARDHGLLRYHIPQVEPRDLDFSTT
HGAVSSTPPAPTLVSGDPWYPWYSWKQPPERELSRLRRLYQGRLREESGPPPELMPEVPL
TAPAEASSTEPGAPQSAL
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggctgcctccatattgaacgtgttgctgaggcgccttcctggcgtttcgcccttcaga
ggtgcctacggagttcaggttctcctccagactctttgcaccaaagctccccctgaggat
gattctttgccccaggttcccatttccccttataaagatgaaccctggaaatatctggac
tcagaagaataccagaaccgctatggttctcgccctgtctgggctgactaccgtcgcaac
cacaaaggtggaatacccccacagcggactcgaaagatgtgtattcggggaaataaagtt
gctgggaatccctgccccatctgccgggatcagaagttgcacgtcgactttaggaacgtg
aagctcttggagcagtttgtctgcgcccacacgggtatcatcttccatgccccgtacaca
ggggtctgtatgaagcaacacaagaagttgacccaggccatccagaaagccagggatcat
ggtcttctcaggtaccacattccccaggttgaaccccgggaccttgacttcagtaccact
catggagctgtgagttctactccgccagcccccactctggtttcaggtgacccctggtac
ccatggtacagctggaaacagccaccagagagagagctgtcccgccttcgccggctctat
cagggccgtcttcgagaagaaagtggccctccacctgagttaatgcccgaggtgcccctt
acagccccagctgaagcctcctccactgagcctggggccccgcaaagtgctctgtag

DBGET integrated database retrieval system