KEGG   Sus scrofa (pig): 100144492Help
Entry
100144492         CDS       T01009                                 

Gene name
CDK4
Definition
cyclin-dependent kinase 4 (EC:2.7.11.22)
Orthology
K02089  
cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
ssc  Sus scrofa (pig)
Pathway
Cell cycle
p53 signaling pathway
PI3K-Akt signaling pathway
Tight junction
T cell receptor signaling pathway
Hepatitis B
Measles
HTLV-I infection
Pathways in cancer
Viral carcinogenesis
Pancreatic cancer
Glioma
Melanoma
Bladder cancer
Chronic myeloid leukemia
Small cell lung cancer
Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100144492 (CDK4)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100144492 (CDK4)
   04115 p53 signaling pathway
    100144492 (CDK4)
  Cellular commiunity
   04530 Tight junction
    100144492 (CDK4)
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    100144492 (CDK4)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100144492 (CDK4)
   05203 Viral carcinogenesis
    100144492 (CDK4)
   05212 Pancreatic cancer
    100144492 (CDK4)
   05214 Glioma
    100144492 (CDK4)
   05220 Chronic myeloid leukemia
    100144492 (CDK4)
   05218 Melanoma
    100144492 (CDK4)
   05219 Bladder cancer
    100144492 (CDK4)
   05222 Small cell lung cancer
    100144492 (CDK4)
   05223 Non-small cell lung cancer
    100144492 (CDK4)
  Infectious diseases
   05166 HTLV-I infection
    100144492 (CDK4)
   05162 Measles
    100144492 (CDK4)
   05161 Hepatitis B
    100144492 (CDK4)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     100144492 (CDK4)
Protein kinases [BR:ssc01001]
 Serine/threonine protein kinases: CMGC group
  CDK family
   100144492 (CDK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 303 aa AA seqDB search
MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGAGGGLPISTVREVALL
RRLEAFEHPNVVRLMDVCATARTDRETKVTLVFEHVDQDLRTYLDKAPPPGLPVETIKDL
MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY
RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR
DVSLPRGAFSPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKAEG
NPE
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggctacctcccggtatgaaccagtggcggagattggtgttggtgcctatgggaccgtg
tacaaagcacgggatccccacagtggccactttgtggccctcaagagcgtaagagtcccc
aatggaggaggtgctggagggggcctgcccatcagcacggttcgtgaagtggccttactg
cgccggctggaggctttcgagcatcccaatgttgtccggctgatggatgtctgtgccact
gcccgaactgatcgagagaccaaagtgaccctggtgtttgagcatgtggaccaagatcta
aggacatatctggacaaggcacccccaccaggcttgccggtggagaccatcaaggatctg
atgcgtcagtttctaagaggcctagatttccttcatgccaactgcatcgttcatcgagac
ctgaagccagagaacattctggttacaagtggtgggacagtcaagctggctgactttggc
ctggccagaatctacagctaccagatggcacttacacctgtggtggttacactctggtac
cgtgctccagaagttcttttgcagtctacgtatgcaacacctgtggacatgtggagcgtt
ggctgtatcttcgcagagatgtttcgtcgaaagcctctcttctgtggaaactctgaagct
gaccagttaggcaaaatctttgacctgattgggctgcccccagaggatgactggccccga
gatgtgtctctaccccgaggagccttttcccccagagggccccgcccagtgcagtcggtg
gtacctgagatggaggagtctggagcacagctgctactggagatgctgacttttaaccca
cacaagcgaatctctgccttccgagccctgcagcactcttatctacataaggcagaaggt
aacccagagtga

DBGET integrated database retrieval system