KEGG   Sus scrofa (pig): 100144492Help
Entry
100144492         CDS       T01009                                 

Gene name
CDK4
Definition
(RefSeq) cyclin-dependent kinase 4
  KO
K02089  cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01522  Endocrine resistance
ssc04110  Cell cycle
ssc04115  p53 signaling pathway
ssc04151  PI3K-Akt signaling pathway
ssc04218  Cellular senescence
ssc04530  Tight junction
ssc04660  T cell receptor signaling pathway
ssc04933  AGE-RAGE signaling pathway in diabetic complications
ssc04934  Cushing's syndrome
ssc05161  Hepatitis B
ssc05162  Measles
ssc05165  Human papillomavirus infection
ssc05166  HTLV-I infection
ssc05167  Kaposi's sarcoma-associated herpesvirus infection
ssc05200  Pathways in cancer
ssc05203  Viral carcinogenesis
ssc05212  Pancreatic cancer
ssc05214  Glioma
ssc05218  Melanoma
ssc05219  Bladder cancer
ssc05220  Chronic myeloid leukemia
ssc05222  Small cell lung cancer
ssc05223  Non-small cell lung cancer
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
Module
ssc_M00692  Cell cycle - G1/S transition
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100144492 (CDK4)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100144492 (CDK4)
   04115 p53 signaling pathway
    100144492 (CDK4)
   04218 Cellular senescence
    100144492 (CDK4)
  Cellular community - eukaryotes
   04530 Tight junction
    100144492 (CDK4)
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    100144492 (CDK4)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100144492 (CDK4)
   05203 Viral carcinogenesis
    100144492 (CDK4)
   05212 Pancreatic cancer
    100144492 (CDK4)
   05225 Hepatocellular carcinoma
    100144492 (CDK4)
   05214 Glioma
    100144492 (CDK4)
   05220 Chronic myeloid leukemia
    100144492 (CDK4)
   05218 Melanoma
    100144492 (CDK4)
   05219 Bladder cancer
    100144492 (CDK4)
   05224 Breast cancer
    100144492 (CDK4)
   05222 Small cell lung cancer
    100144492 (CDK4)
   05223 Non-small cell lung cancer
    100144492 (CDK4)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100144492 (CDK4)
   04934 Cushing's syndrome
    100144492 (CDK4)
  Infectious diseases
   05166 HTLV-I infection
    100144492 (CDK4)
   05162 Measles
    100144492 (CDK4)
   05161 Hepatitis B
    100144492 (CDK4)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100144492 (CDK4)
   05165 Human papillomavirus infection
    100144492 (CDK4)
  Drug resistance
   01522 Endocrine resistance
    100144492 (CDK4)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     100144492 (CDK4)
Protein kinases [BR:ssc01001]
 Serine/threonine kinases: CMGC group
  CDK family
   100144492 (CDK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kdo Haspin_kinase Kinase-like
Motif
Other DBs
NCBI-GeneID: 100144492
NCBI-ProteinID: NP_001116569
Ensembl: ENSSSCG00000025092
UniProt: P79432
Position
5
AA seq 303 aa AA seqDB search
MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGAGGGLPISTVREVALL
RRLEAFEHPNVVRLMDVCATARTDRETKVTLVFEHVDQDLRTYLDKAPPPGLPVETIKDL
MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY
RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR
DVSLPRGAFSPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKAEG
NPE
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggctacctcccggtatgaaccagtggcggagattggtgttggtgcctatgggaccgtg
tacaaagcacgggatccccacagtggccactttgtggccctcaagagcgtaagagtcccc
aatggaggaggtgctggagggggcctgcccatcagcacggttcgtgaagtggccttactg
cgccggctggaggctttcgagcatcccaatgttgtccggctgatggatgtctgtgccact
gcccgaactgatcgagagaccaaagtgaccctggtgtttgagcatgtggaccaagatcta
aggacatatctggacaaggcacccccaccaggcttgccggtggagaccatcaaggatctg
atgcgtcagtttctaagaggcctagatttccttcatgccaactgcatcgttcatcgagac
ctgaagccagagaacattctggttacaagtggtgggacagtcaagctggctgactttggc
ctggccagaatctacagctaccagatggcacttacacctgtggtggttacactctggtac
cgtgctccagaagttcttttgcagtctacgtatgcaacacctgtggacatgtggagcgtt
ggctgtatcttcgcagagatgtttcgtcgaaagcctctcttctgtggaaactctgaagct
gaccagttaggcaaaatctttgacctgattgggctgcccccagaggatgactggccccga
gatgtgtctctaccccgaggagccttttcccccagagggccccgcccagtgcagtcggtg
gtacctgagatggaggagtctggagcacagctgctactggagatgctgacttttaaccca
cacaagcgaatctctgccttccgagccctgcagcactcttatctacataaggcagaaggt
aacccagagtga

DBGET integrated database retrieval system