KEGG   Sus scrofa (pig): 100144537Help
Entry
100144537         CDS       T01009                                 

Gene name
PPT2
Definition
(RefSeq) lysosomal thioesterase PPT2 precursor
  KO
K01074  palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00062  Fatty acid elongation
ssc01100  Metabolic pathways
ssc01212  Fatty acid metabolism
ssc04142  Lysosome
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Lipid metabolism
   00062 Fatty acid elongation
    100144537 (PPT2)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100144537 (PPT2)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     100144537 (PPT2)
Lipid biosynthesis proteins [BR:ssc01004]
 Fatty acid synthase
  Component type
   100144537 (PPT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Palm_thioest Abhydrolase_1 DUF676 Abhydrolase_6 PGAP1 Lipase_2 Hydrolase_4
Motif
Other DBs
NCBI-GeneID: 100144537
NCBI-ProteinID: NP_001116639
Ensembl: ENSSSCG00000001433
Vega: OTTSUSG00000001352
UniProt: A5A8Z8
Position
7
AA seq 309 aa AA seqDB search
MKSCGSMLGLQGLRLPPAGFLLLLPFLLLLLLPAAPAPHRVSYKPVIVVHGLFDSSYSFR
HLLEYINETHPGTVVTVLDLFDGRESLRPLWEQVQGFREAVAPIMAKAPQGVHLICYSQG
GLVCRALLSVMDEHNVDSFISLSSPQMGQYGDTDYLKWLFPTSMRSNLYRICYSPWGQEF
SICNYWHDPHHDDLYLNASSFLALINGERDHPNATAWRKNFLRVGRLVLIGGPDDGVITP
WQSSFFGFYDANETVLEMEEQLVYLRDSFGLKTLLARGAIVRCPMAGISHTAWHSNRTLY
ETCMEPWLS
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaagagttgcggcagcatgctggggctccaagggctgcggctcccaccggcgggattc
ctgcttctgttgccattcctgctgttgctgctactgccggcagcccctgcgccccaccgg
gtttcctacaagccggtcatcgtggtgcatgggctctttgacagctcgtacagcttccgc
cacctgctggaatacatcaacgagacacatcccggaactgtggtgacagtgcttgatctc
ttcgatgggagagagagtttgcggcccctgtgggaacaggtgcaagggttccgagaggct
gtggcccccatcatggcaaaggcccctcaaggggtgcatctcatctgctactcgcagggg
ggcctggtgtgccgggcactgctctctgtgatggatgaacacaatgtggactctttcatc
tctctctcctctccacagatgggacagtatggagacacggactatttgaagtggctattc
cctacctccatgaggtctaacctctaccggatctgctatagcccctggggccaggaattc
tccatctgcaattactggcacgacccccatcatgatgacttgtacctcaatgccagcagt
tttctggccctgatcaatggggaaagagaccatcccaatgctactgcttggcggaagaac
tttcttcgtgtgggccgcctggtgctgattgggggccctgatgatggtgtcattaccccc
tggcagtccagcttctttggtttctatgatgcaaatgagacggtcttggagatggaagag
caactggtttatcttcgtgattcttttgggttgaagactctcttggcccggggggccata
gtgaggtgtccaatggctgggatctcccacacagcctggcactccaaccgtaccctttat
gagacctgcatggaaccttggctctcctga

DBGET integrated database retrieval system