KEGG   Sus scrofa (pig): 100144537Help
Entry
100144537         CDS       T01009                                 

Gene name
PPT2
Definition
palmitoyl-protein thioesterase 2 (EC:3.1.2.22)
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
ssc  Sus scrofa (pig)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Class
Metabolism; Overview; Fatty acid metabolism [PATH:ssc01212]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:ssc00062]
Cellular Processes; Transport and catabolism; Lysosome [PATH:ssc04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Vega: 
UniProt: 
Position
7
AA seq 309 aa AA seqDB search
MKSCGSMLGLQGLRLPPAGFLLLLPFLLLLLLPAAPAPHRVSYKPVIVVHGLFDSSYSFR
HLLEYINETHPGTVVTVLDLFDGRESLRPLWEQVQGFREAVAPIMAKAPQGVHLICYSQG
GLVCRALLSVMDEHNVDSFISLSSPQMGQYGDTDYLKWLFPTSMRSNLYRICYSPWGQEF
SICNYWHDPHHDDLYLNASSFLALINGERDHPNATAWRKNFLRVGRLVLIGGPDDGVITP
WQSSFFGFYDANETVLEMEEQLVYLRDSFGLKTLLARGAIVRCPMAGISHTAWHSNRTLY
ETCMEPWLS
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaagagttgcggcagcatgctggggctccaagggctgcggctcccaccggcgggattc
ctgcttctgttgccattcctgctgttgctgctactgccggcagcccctgcgccccaccgg
gtttcctacaagccggtcatcgtggtgcatgggctctttgacagctcgtacagcttccgc
cacctgctggaatacatcaacgagacacatcccggaactgtggtgacagtgcttgatctc
ttcgatgggagagagagtttgcggcccctgtgggaacaggtgcaagggttccgagaggct
gtggcccccatcatggcaaaggcccctcaaggggtgcatctcatctgctactcgcagggg
ggcctggtgtgccgggcactgctctctgtgatggatgaacacaatgtggactctttcatc
tctctctcctctccacagatgggacagtatggagacacggactatttgaagtggctattc
cctacctccatgaggtctaacctctaccggatctgctatagcccctggggccaggaattc
tccatctgcaattactggcacgacccccatcatgatgacttgtacctcaatgccagcagt
tttctggccctgatcaatggggaaagagaccatcccaatgctactgcttggcggaagaac
tttcttcgtgtgggccgcctggtgctgattgggggccctgatgatggtgtcattaccccc
tggcagtccagcttctttggtttctatgatgcaaatgagacggtcttggagatggaagag
caactggtttatcttcgtgattcttttgggttgaagactctcttggcccggggggccata
gtgaggtgtccaatggctgggatctcccacacagcctggcactccaaccgtaccctttat
gagacctgcatggaaccttggctctcctga

DBGET integrated database retrieval system