KEGG   Sus scrofa (pig): 100152135Help
Entry
100152135         CDS       T01009                                 

Definition
histone H2B type 1-A-like
Orthology
K11252  
histone H2B
Organism
ssc  Sus scrofa (pig)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100152135
  Immune diseases
   05322 Systemic lupus erythematosus
    100152135
  Substance dependence
   05034 Alcoholism
    100152135
Exosome [BR:ssc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100152135
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 127 aa AA seqDB search
MPELSSKGATISKKGFKKAATKTQKKEGKKRRRGRKESYSIYIYKVLKQVHPDTGISSKA
MSIMNSFVTDIFERIAGEASRLAHYSKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAV
TKYTSSK
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgccggagctgtcttcgaagggcgcgaccatctctaaaaaaggtttcaaaaaagccgca
actaaaactcagaagaaagaaggaaaaaagcgcagaagaggccggaaagagagctattcg
atctatatttacaaggtgcttaagcaagttcatccagataccggtatttcttccaaggcc
atgagcatcatgaattcgtttgtcactgatatctttgagcgcatcgcaggtgaagcatcg
cgtttggcacactacagcaagcgttccactatcacttccagagagatccaaacggctgtg
cgtctcttgctgccgggagagttggccaagcatgcagtgtctgagggcaccaaagctgtc
accaagtatactagctccaagtaa

DBGET integrated database retrieval system