KEGG   Sus scrofa (pig): 100152172Help
Entry
100152172         CDS       T01009                                 

Definition
ubiquitin carboxyl-terminal hydrolase 15-like
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
ssc  Sus scrofa (pig)
Brite
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100152172
Peptidases [BR:ssc01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100152172
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 494 aa AA seqDB search
TIEKEIRKIFNIPDEKETRLWNKYMSNTFEPLNKPDSTIQDAGLYQGQVLVIEQKNEDGT
WPRGPSTPKSPGASNFSTLPKISPSSLSNNYNNINNRNVKNSNYCLPSYTAYKNYDYSEP
GRNNEQPGLCGLSNLGNTCFMNSAIQCLSNTPPLTEYFLNDKYQEELNFDNPLGMRGEIA
KSYAELIKQMWSGKFSYVTPRAFKTQVGRFAPQFSGYQQQDCQELLAFLLDGLHEDLNRI
RKKPYIQLKDADGRPDKVVAEEAWENHLKRNDSIIVDIFHGLFKSTLVCPECAKISVTFD
PFCYLTLPLPMKKERTLEVYLVRMDPLTKPMQYKVVVPKIGNILDLCTALSTLSGVPADK
MIVTDIYNHRFHRIFAMDENLSSIMERDDIYVFEININRTEDTEHVIIPVCLREKFRHSS
YTHHTGSSLFGQPFLMAVPRNNTEDKLYNLLLVRMCRYVKISTETEETEGSLHCCKDQNI
NGNGPNGIHEEGSP
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atacaattgaaaaggaaataagaaaaatcttcaatattccagatgaaaaggagaccagat
tgtggaacaaatacatgagtaatacatttgaaccactgaataaaccagacagcaccattc
aggatgctggtttataccaaggacaggtgttagtgatagaacagaaaaatgaagatggaa
catggccaaggggtccttctacacctaagtccccaggtgcatccaatttttcaactttac
caaagatctctccttcatctctatcaaataattataacaacatcaacaacagaaatgtga
aaaactcaaattattgtctcccatcctatactgcttataagaactatgattattcagaac
ctggaagaaacaatgaacagccaggcctctgtggccttagtaacttgggaaatacatgtt
tcatgaattcagctattcagtgtttgagcaatacaccaccacttaccgaatatttcctga
atgataagtatcaagaagagctgaattttgacaatcccttaggaatgagaggtgaaatag
ctaaatcttacgccgaattgatcaagcaaatgtggtctggaaaatttagctacgttacac
caagggcctttaagactcaggtaggacgttttgcacctcagttctctggataccagcagc
aggactgtcaagaactattagctttcctattagatggactgcatgaggatttgaatagaa
ttaggaaaaaaccatatatacaattaaaagatgctgatggaaggccagataaggtagttg
ctgaagaagcctgggaaaaccatttaaaaagaaatgattctatcattgtagatatatttc
atggcctttttaaatcaactttagtttgtcctgaatgtgctaagatttcagtaacatttg
atcctttttgttacctgacacttccattgcccatgaaaaaagaacgtaccttggaagttt
atttagttagaatggatccacttaccaaacctatgcagtacaaagtggttgtccccaaaa
ttggaaacatacttgatctttgtacagcgttgtctactctttcaggagtacctgcagata
agatgatagttactgatatatacaatcatagatttcacagaatatttgctatggatgaaa
accttagtagtattatggaacgggatgatatttatgtgtttgaaattaacatcaatagga
cagaagatacagagcatgtgattattcctgtttgcctgagagaaaaatttagacactcaa
gttatacccaccatactggttcctcactttttggtcagccttttcttatggctgtaccac
gaaacaatactgaagataaactctataatcttctgcttgtgagaatgtgccgatatgtca
aaatatctactgaaacagaagaaactgaaggatccctacactgctgtaaggaccaaaata
ttaatgggaatggcccaaatggaatccatgaggaaggttcaccaa

DBGET integrated database retrieval system