KEGG   Sus scrofa (pig): 100152458Help
Entry
100152458         CDS       T01009                                 

Gene name
USP45
Definition
ubiquitin specific peptidase 45
Orthology
K11844  
ubiquitin carboxyl-terminal hydrolase 16/45 [EC:3.1.2.15]
Organism
ssc  Sus scrofa (pig)
Brite
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100152458 (USP45)
Peptidases [BR:ssc01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100152458 (USP45)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 817 aa AA seqDB search
MRVKEPSKALTEKAKRSKRPTIPHDEDSSDDIAVGFTCQHVSHAINVNHVKRAITENLWS
VCSECLKERRFSDGQPVLLSDIWLCLKCGFQGCGKNSESQHSVKHFNSWRAELHCIIISL
STWIIWCYECDEKLSTHCNKKVLAQIVDFLQKHVSKTQTNAFSRIIKLCEEKYETGEKNK
GRKSSSVTSVKGITNLGNTCFFNAVMQNLAQSYILTELMNEIKEHGVKLRIVPSLDSQLD
PLVVELSSPGPLTSALFLFLHSMKETEKGPLSPKILFNQLCQKAPGFKSLQQQDSQELLH
YLLDAVRTEETKRIQAGILKAFNNPTTKTADDETRKKVKAYGREGVKMNFIDRIFIGELT
STVMCEECANISTVKDPFIDISLPIIEERVSKPVLLGRTSKYRSLQETDNSQYSGSVTVE
NTQQPKATKKHSPSKDMNQLIHGRKCIRKLSSGDDKAAVMYQKNENLETDGGSSLFASVR
STESTLTESPTDGSEKEASLSDSSVDADSEASESESAPKQTLLLRSGNSYCVHTNGHLRH
PSESEPPARESDSGDDGVAQAVSELRLSSAVAGDGDFDRENPLLNVSNNLCFSENKQMVP
QGPQNAFQTLSQSYITTSKECSIQSCLYQFTSMELLMGNNKLLCEHCTEKKQKYQKETSS
AEKKAEGVYTNARKQLLISAVPAILILHLKRFHQAGLSLRKVNRHVDFPLTLDLAPFCSA
TCKNVCVGDKVLYGLYGVVEHSGSMRGGHYTAYVKVRTPSRKLLEHITGKKNIPGLKEPD
SESAGQWVHVSDTYVQVVPESRALSAQAYLLFYERIF
NT seq 2454 nt NT seq  +upstreamnt  +downstreamnt
atgcgggtgaaagagccatccaaagctttaactgagaaagccaaaagaagtaaaagacct
actatacctcatgatgaagactcttcagatgacattgctgtaggtttcacttgccaacat
gtaagccatgctatcaatgtgaatcatgtgaaaagagcaataactgagaatctgtggtca
gtttgctcggaatgtttaaaagagagacgattctctgatggacagccagtactgctttct
gatatttggttgtgcctcaagtgtggttttcagggatgtggtaagaactcagaaagccag
cattcagtgaagcacttcaatagttggagagcagagcttcattgtattataattagccta
agcacatggattatatggtgttatgagtgtgatgagaaattatcaacacattgtaataag
aaggttttggctcagatagttgattttctccagaaacatgtttctaaaacacaaacaaat
gcattttctagaatcataaaactttgtgaagaaaaatatgaaacaggtgaaaagaataag
ggaagaaaaagcagcagtgtaacatctgtaaaaggaattacgaatttaggaaatacctgc
ttttttaatgcagtcatgcagaatttggcacagtcttacattcttactgaactgatgaat
gagatcaaagaacatggtgtgaaactcaggattgttccttccttagactctcaactggac
ccattagtggtggaactttcaagccctggaccgttgacctcagccttgttcctgtttctt
cacagcatgaaggagactgaaaaaggaccactttctcctaaaattctttttaatcagctt
tgtcagaaggcccctggatttaaaagtctccagcagcaggacagtcaggagcttcttcat
tatcttctggatgcagtcaggacagaagaaacaaagcgaatacaagctggcattctaaaa
gcgtttaacaacccaactactaaaactgctgatgatgaaactagaaaaaaagtcaaagca
tatggaagagaaggtgtgaaaatgaacttcatagatcgtatctttattggtgaattaact
agcacggtcatgtgtgaagaatgtgcaaatatctccacagtgaaagatccttttattgat
atttcacttcctataatagaagagagggtttcaaaacctgtacttttgggaagaacgagt
aaatatagaagcttacaggagacagataatagtcagtacagtggctctgttactgtagaa
aatactcagcaacccaaagccaccaagaagcattctccatctaaagatatgaatcaacta
attcatggcagaaaatgtataagaaaattgtcatctggagatgataaggctgctgtcatg
taccagaaaaacgaaaaccttgaaacggatggaggctcttcattgtttgcaagcgtcagg
agcactgagtccactctgactgaaagccctaccgatggcagtgaaaaagaagccagcctt
tctgacagcagtgttgatgctgacagtgaggcttcagagtctgaaagtgcccctaaacag
actttgttgttgaggtctggcaacagctactgtgtgcacacaaatggacaccttcgccac
ccatcagaaagtgaaccacccgccagggagagtgacagcggtgatgacggagtggctcaa
gctgtttctgaacttcgtttgagcagcgctgtagctggagatggggattttgaccgagaa
aatccgctgctaaatgtttcaaataatttatgtttttcagagaataagcaaatggtgcct
caaggcccccaaaatgcttttcagaccctttctcagagttatataaccacttctaaagaa
tgttcaattcaatcctgtctctatcagtttacgtctatggaattactaatggggaataac
aaacttctgtgtgagcactgtactgaaaagaagcagaagtaccaaaaggaaaccagttct
gcagaaaagaaagcagaaggggtttatacaaatgccaggaagcaactgctcatttctgct
gttccagctatcctaattctccatcttaaaagatttcatcaggctggcttgagtcttcgc
aaagtaaacagacatgtggattttccacttacgcttgatttagcaccattctgttctgcc
acttgtaagaatgtatgtgtgggtgataaagttctctatggtctgtatggcgtagtagaa
cacagtggctcaatgagaggaggtcactacactgcttatgtgaaagtgagaacaccctcc
aggaaattattggaacatatcactggaaagaaaaatataccaggtttgaaagaacctgat
agtgaatcagcaggccagtgggtccatgttagtgacacttatgtgcaggtggttccagaa
tcaagagcactaagtgcacaagcgtaccttcttttttatgaaagaatattctaa

DBGET integrated database retrieval system