KEGG   Sus scrofa (pig): 100152497Help
Entry
100152497         CDS       T01009                                 

Gene name
PLCG1
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 isoform X1
  KO
K01116  phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00562  Inositol phosphate metabolism
ssc01100  Metabolic pathways
ssc01521  EGFR tyrosine kinase inhibitor resistance
ssc04012  ErbB signaling pathway
ssc04014  Ras signaling pathway
ssc04015  Rap1 signaling pathway
ssc04020  Calcium signaling pathway
ssc04064  NF-kappa B signaling pathway
ssc04066  HIF-1 signaling pathway
ssc04070  Phosphatidylinositol signaling system
ssc04072  Phospholipase D signaling pathway
ssc04360  Axon guidance
ssc04370  VEGF signaling pathway
ssc04650  Natural killer cell mediated cytotoxicity
ssc04658  Th1 and Th2 cell differentiation
ssc04659  Th17 cell differentiation
ssc04660  T cell receptor signaling pathway
ssc04664  Fc epsilon RI signaling pathway
ssc04666  Fc gamma R-mediated phagocytosis
ssc04670  Leukocyte transendothelial migration
ssc04722  Neurotrophin signaling pathway
ssc04750  Inflammatory mediator regulation of TRP channels
ssc04919  Thyroid hormone signaling pathway
ssc04933  AGE-RAGE signaling pathway in diabetic complications
ssc05167  Kaposi's sarcoma-associated herpesvirus infection
ssc05169  Epstein-Barr virus infection
ssc05200  Pathways in cancer
ssc05205  Proteoglycans in cancer
ssc05206  MicroRNAs in cancer
ssc05214  Glioma
ssc05223  Non-small cell lung cancer
ssc05225  Hepatocellular carcinoma
ssc05231  Choline metabolism in cancer
Module
ssc_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100152497 (PLCG1)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100152497 (PLCG1)
   04015 Rap1 signaling pathway
    100152497 (PLCG1)
   04012 ErbB signaling pathway
    100152497 (PLCG1)
   04370 VEGF signaling pathway
    100152497 (PLCG1)
   04064 NF-kappa B signaling pathway
    100152497 (PLCG1)
   04066 HIF-1 signaling pathway
    100152497 (PLCG1)
   04020 Calcium signaling pathway
    100152497 (PLCG1)
   04070 Phosphatidylinositol signaling system
    100152497 (PLCG1)
   04072 Phospholipase D signaling pathway
    100152497 (PLCG1)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    100152497 (PLCG1)
   04660 T cell receptor signaling pathway
    100152497 (PLCG1)
   04658 Th1 and Th2 cell differentiation
    100152497 (PLCG1)
   04659 Th17 cell differentiation
    100152497 (PLCG1)
   04664 Fc epsilon RI signaling pathway
    100152497 (PLCG1)
   04666 Fc gamma R-mediated phagocytosis
    100152497 (PLCG1)
   04670 Leukocyte transendothelial migration
    100152497 (PLCG1)
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100152497 (PLCG1)
  Nervous system
   04722 Neurotrophin signaling pathway
    100152497 (PLCG1)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100152497 (PLCG1)
  Development
   04360 Axon guidance
    100152497 (PLCG1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100152497 (PLCG1)
   05231 Choline metabolism in cancer
    100152497 (PLCG1)
   05206 MicroRNAs in cancer
    100152497 (PLCG1)
   05205 Proteoglycans in cancer
    100152497 (PLCG1)
   05225 Hepatocellular carcinoma
    100152497 (PLCG1)
   05214 Glioma
    100152497 (PLCG1)
   05223 Non-small cell lung cancer
    100152497 (PLCG1)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100152497 (PLCG1)
  Infectious diseases
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100152497 (PLCG1)
   05169 Epstein-Barr virus infection
    100152497 (PLCG1)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    100152497 (PLCG1)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100152497 (PLCG1)
Membrane trafficking [BR:ssc04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100152497 (PLCG1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100152497 (PLCG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y SH3_1 C2 PH SH3_9 SH3_2 PH_12 GDPD
Motif
Other DBs
NCBI-GeneID: 100152497
NCBI-ProteinID: XP_020934047
Ensembl: ENSSSCG00000007356
Position
17
AA seq 1291 aa AA seqDB search
MAGAASPCANGCGPGAPSDAEVLHLCRSLEVGTVMTLFYSKKSQRPERKTFQVKLETRQI
TWSRGADKIEGAIDIREIKEIRPGKTSRDFDRYQEDPAFRPDQSHCFVILYGMEFRLKTL
SLQATSEDEVNMWIKGLTWLMEDTLQAATPLQIERWLRKQFYSVDRNREDRISAKDLKNM
LSQVNYRVPNMRFLRERLTELEQRSSDITYGQFAQLYRSLMYSAQKTMDLPFLEASTLRA
GERPELCRVSLPEFQQFLLEYQGELWAVDRLQVQEFMLSFLRDPLREIEETYFFLDEFVT
FLFSKENSVWNSQLDAVCPDTMNNPLSHYWISSSHNTYLTGDQFSSESSLEAYARCLRMG
CRCIELDCWDGPDGMPVIYHGHTLTTKIKFSDVLHTIKEHAFVASEYPVILSIEDHCSIA
QQRNMAQYFKKVLGDTLLTKPVDIAADGLPSPNQLKRKILIKHKKLAEGSAYEEVPTSVM
YSENDISNSIKNGILYLEDPVNHEWYPHYFVLTSSKIYYSEETSSDQGNEDEEEPKEASS
STELHSNEKWFHGKLGAGRDGRHIAERLLTEYCIETGAPDGSFLVRESETFVGDYTLSFW
RNGKVQHCRIHSRQDAGTPKFFLTDNLVFDSLYDLITHYQQVPLRCNEFEMRLSEPVPQT
NAHESKEWYHASLTRAQAEHMLMRVPRDGAFLVRKRNEPNSYAISFRAEGKIKHCRVQQE
GQTVMLGNSEFDSLVDLVSYYEKHPLYRKMKLRYPINEEALEKIGTAEPDYGALYEGRNP
GFYVEANPMPTFKCAVKALFDYKAQRDDELTFTKSAIIQNVEKQEGGWWRGDYGGKKQLW
FPSNYVEEMVSPAALEPEREHLDENSPLGDLLRGVLDVPACQIAIRPEGKNNRLFVFSIS
MASVAHWSLDVAADSQEELQDWVKKIREVAQTADARLTEGKMMERRKKIALELSELVVYC
RPVPFDEEKIGTERACYRDMSSFPETKAEKYVNKAKGKKFLQYNRLQLSRIYPKGQRLDS
SNYDPLPMWICGSQLVALNFQTPDKPMQMNQALFMAGGHCGYVLQPSTMRDEAFDPFDKS
SLRGLEPCAICVEVLGARHLPKNGRGIVCPFVEIEVAGAEYDSIKQKTEFVVDNGLNPVW
PAKLFHFQISNPEFAFLRFVVYEEDMFSDQNFLAQATFPVKGLKTGYRAVPLKNNYSEDL
ELASLLIKLDIFPVKQENSDLSPFGGTSLRERGYDISGQPAHGRAREGSFEARYQQPFED
FRISQEHLADHFDSRERRAPRRTRVNGDNRL
NT seq 3876 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcgccgcgtccccctgcgccaatggctgcgggccgggcgcaccctcggacgcc
gaggtgttgcacctctgccgcagcctcgaggtgggcaccgtcatgactttgttctactcc
aagaagtcgcagcggcccgaacggaagaccttccaggtcaagctggagacgcggcagatc
acgtggagccgtggcgccgacaagatcgagggggccattgacattcgcgaaatcaaggag
atccgcccagggaagacctcccgggactttgatcgataccaagaggatcctgcttttcga
ccagaccagtcacactgctttgtcatcctgtatggaatggaattccgcctgaagaccctg
agtctgcaggctacctctgaggacgaagtgaacatgtggatcaagggcttgacttggctg
atggaggacacgctgcaggcggccacgcctctgcagattgagaggtggctgcggaagcag
ttctactcagtggaccggaatcgtgaggatcgtatatcagccaaggatctgaagaacatg
ctgtcccaggtcaactaccgggtccccaacatgcgcttcctccgagagcggctgacggag
ctggagcagcgcagcagcgacatcacctacggacagtttgcacaactgtaccgcagcctc
atgtacagcgcccagaagacgatggacctccccttcctggaagccagtaccctaagggca
ggggagcggccagagctctgccgggtgtcccttcctgagttccagcagttcctcctcgag
taccagggggagctgtgggctgtcgaccggctccaggtgcaggagttcatgctcagcttc
ctccgagaccccttgcgagagatagaggagacttacttcttcctggacgagtttgtcacc
ttcctgttctccaaggagaacagcgtgtggaactcgcagctggatgccgtgtgcccagac
accatgaacaaccccctttcccactactggatctcctcctctcacaacacgtacctgacc
ggggaccagttctccagcgagtcctccctggaagcctacgcccgctgcctgcggatgggc
tgccgctgcattgagttggactgctgggacggcccagacgggatgccggtcatttaccat
ggacacactctgaccaccaagatcaagttctcagacgtcctgcacaccatcaaggagcac
gcctttgtggcctcagagtacccggtcatcctgtccatcgaggaccactgcagcattgcc
cagcagaggaacatggcccagtatttcaagaaggtgctcggggacacgctcctcaccaag
cccgtggacatcgcggccgacgggctcccctcacccaatcagctcaagaggaagatcctc
atcaagcacaagaagctggctgagggcagtgcgtatgaggaggtgcctacgtctgtgatg
tactctgagaacgacatcagcaactccatcaagaacggcatcctctacctggaggaccct
gtgaaccacgagtggtatccccactactttgttctgaccagcagcaagatctactactca
gaggagaccagcagtgaccagggcaacgaggatgaggaggagcccaaggaggcgagcagc
agcacagagctgcattccaatgagaagtggttccacgggaagctcggggcggggcgggac
ggccggcacatcgccgagcgcctgctcacagagtactgcatcgagaccggagccccggac
ggctccttcctcgtgcgcgagagtgagaccttcgtgggtgactacaccctctccttctgg
cggaacgggaaagtccagcactgccggatccactcccggcaggacgctgggacccccaag
ttcttcctgacagacaacctcgtcttcgactcactctacgacctcatcacacactaccag
caggtgcccctgcgctgcaacgagtttgagatgcgcctctctgagccggtcccgcagacc
aacgcccacgagagcaaagagtggtaccacgcgagcctgaccagagcgcaggccgagcac
atgctgatgcgcgtgccccgggacggggccttcctggtgcggaaacgcaatgagcccaac
tcctacgccatctccttccgggctgagggcaagatcaagcattgccgtgtccagcaggag
ggccagactgtgatgctgggcaactcggagtttgacagcctcgtggatcttgtcagctac
tatgagaagcacccgctgtaccgcaagatgaagctgcgctatcccatcaacgaggaggca
ttggagaagatcggcacagctgagcctgactacggggccctgtatgagggccgcaaccct
ggcttctacgtggaggccaaccctatgccgactttcaagtgtgccgtcaaagcgctcttc
gactacaaggcccagagagatgacgagctgaccttcaccaagagcgccatcatccagaac
gtggagaagcaggagggaggctggtggcggggggactatggtgggaagaagcagctgtgg
tttccgtccaactacgtggaagagatggtcagccctgcggccctggagcccgagagggag
cacttggacgagaacagccccctgggggacttgctgcggggggtcttggatgtgccagcc
tgtcagatagccatccgtcctgagggcaagaacaacaggctcttcgtcttctccatcagc
atggcgtcggtggcacattggtccttggatgtggctgctgactcacaggaggagctgcag
gactgggtgaaaaagatccgagaggtggcccagaccgcggatgccaggctcacagagggg
aagatgatggagcggaggaagaaaatcgccttggagctttctgagctcgtcgtctactgc
cggcctgttcccttcgatgaagagaagatcggcacagaacgcgcctgctaccgggacatg
tcgtccttcccggaaaccaaggctgagaagtatgtgaacaaggccaaaggcaagaagttc
ctccagtacaaccggctgcagctgtcgcgcatctaccccaagggccagcggctggactcc
tccaattatgaccccttgcccatgtggatctgtggcagtcagctggtggccctcaacttc
cagaccccagacaagccgatgcagatgaaccaggctctcttcatggccggcgggcactgc
ggctacgtgctgcagccaagcaccatgagggacgaggccttcgaccccttcgacaagagc
agcctccgcgggctggagccgtgcgccatctgtgttgaggtgctgggggcccggcatctg
ccgaagaatggccgaggcattgtgtgtccttttgtggagattgaggtggccggagcagag
tatgacagcatcaagcagaagacagagtttgtggtggacaacggactgaaccccgtgtgg
ccggccaagctcttccacttccagatcagtaaccccgaatttgccttcctgcgctttgtg
gtgtatgaagaagacatgtttagcgaccagaacttcctggctcaggccaccttcccggtg
aagggactgaagacgggatacagagcggtgcctttgaagaacaactacagcgaggacctg
gagttggcctccctgctcatcaagctcgacattttccccgtcaagcaggagaacagcgac
ctcagtccctttggggggacgtccctgcgggagcggggctacgacatctctggccagccg
gcacacggccgggcccgggagggctccttcgaagcccgctaccagcagccgtttgaggac
ttccgcatctcccaggagcatctcgcagaccattttgacagtcgggagcgaagggcccca
cgaaggactcgggtcaatggagacaaccgcctctag

DBGET integrated database retrieval system