KEGG   Sus scrofa (pig): 100152651Help
Entry
100152651         CDS       T01009                                 

Gene name
STAMBPL1
Definition
STAM binding protein-like 1 (EC:3.1.2.15)
Orthology
K11867  
AMSH-like protease [EC:3.1.2.15]
Organism
ssc  Sus scrofa (pig)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
14
AA seq 436 aa AA seqDB search
MDQPFTVNALRKLAAMPDHTDVSLSPEERVRALSKLGCNITINEDITPRRYFRSGVEMER
MASVYLEEGNLENAFVLYNKFITLFVEKLPSHRDYQQCAVPEKQDIMKKLKEIAFPRTDE
LKKDLLKKYNIQYQEYLQSKNKYKAEVLKKLEHQRLIEAERKRVAQMRQQQLESEQFLFF
EDQLKKQELARGQMRSQETPALSEQTDGSALSCFSTHQNNSLLDVFADQPNKSDATNYAG
HSPPVNRALKPAATLSAGQNLVVEGLRYVVLSRDLCHRFLLLAESNTVRGIETCGILCGK
LTHNEFTITHLIVPKQSAGPDYCDVENVEELFSVQDQHDLLTLGWIHTHPTQTAFLSSVD
LHTHCSYQLMLPEAIAIVCSPKHKDTGIFRLTDAGMLEVSACKKKGFHPHTKDPRLFSIC
KHVLVKDIKIIVLDLR
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atggatcagccattcactgtgaatgctctgagaaagttagccgccatgcctgaccataca
gacgtttccctcagcccggaagagcgagtccgcgccctcagcaagctgggttgtaatatt
accatcaacgaagacatcactccgcggcgctactttcgatccggagtagaaatggagagg
atggcctcggtgtatttggaagaaggaaacttggaaaatgcctttgttctttataataaa
tttataactttgtttgtagaaaagcttcccagccatcgagattaccagcaatgtgcggta
cccgaaaagcaggacattatgaagaaactgaaggagattgcattcccaaggacagatgaa
ttgaaaaaggaccttttaaagaaatataacatacaataccaagaatatttgcaaagcaaa
aacaaatataaagctgaagttctcaaaaaactggagcatcagagattgatagaggcggaa
aggaagcgggtcgctcagatgcgccagcagcagctggaatcggaacagtttttgtttttt
gaagatcagctcaagaagcaagaattagcccggggtcagatgcgaagccaggaaacccca
gcactgtcggagcagactgatgggagtgctttgtcctgcttctccactcaccagaacaat
tccttgctggatgtatttgcagatcagcctaataaaagtgatgcaaccaattatgctggc
cactctcctccggtaaacagggccttaaaaccagctgctactctaagtgctggtcagaat
ttagtggtggaaggactgcgatatgtagttttatcaagagatctttgccacagatttctg
ctactggcagaatctaatacagtgagaggaatagaaacctgtggaattctctgtggaaaa
ctgacgcataatgaatttactattacccacttaattgtgccaaagcagtctgcgggacca
gactattgtgacgtggagaatgtagaggaattattcagtgttcaggatcaacacgatctc
ctcactctaggatggatccacacacatccgacccagactgcattcttatccagtgttgac
ctccacactcactgttcctatcagcttatgttgccagaagcgattgccattgtttgttca
ccaaagcataaagacactggcatcttcaggctcacagacgctggcatgcttgaggtttct
gcgtgtaaaaagaagggctttcatccacataccaaggatcccaggctgttcagtatctgc
aaacatgtgttggtaaaagacataaaaataatcgtgctggatctgaggtga

DBGET integrated database retrieval system