KEGG   Sus scrofa (pig): 100152653Help
Entry
100152653         CDS       T01009                                 

Gene name
ART4, DO
Definition
ADP-ribosyltransferase 4 (Dombrock blood group) (EC:2.4.2.31)
Orthology
K06717  
ADP-ribosyltransferase 4 [EC:2.4.2.31]
Organism
ssc  Sus scrofa (pig)
Brite
Enzymes [BR:ssc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     100152653 (ART4)
Cellular antigens [BR:ssc04090]
 Proteins
  100152653 (ART4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Vega: 
UniProt: 
Position
5
AA seq 322 aa AA seqDB search
MKLQVRRSIFNPSKSRPLTHRGRRTPLPTAAAPEVRIWLLKGPLPLLLLCSSLQSPTVAV
KIDFDLAPVSFDDQYQGCSQQVLEELILEDYFTKELAAHEYHKVWQRALLAWLNQAKAPP
KDMAIAHAVAILVYSSNNSVRSDFIRAMASAARSSQQYKNSFHFKYLHYYLTTAIQLLRK
EMVRRNDSLCYEVHHKVEGVYLSASTGATIRFGQFLSTSLLREEAQKFGKQTLFTILTCL
GAPVQDISLKKEVLVPPYELFEVVNTSYHPRGNWLQLRSTGNLSTYNCQLLKASSKKCIP
TPAVIASLSFLTSVIISSKSGT
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgcaagtacgaagaagtattttcaacccaagcaaaagccgtccattgacccac
agaggcaggaggactcctcttccaactgctgcagcccctgaagtgagaatctggctcctg
aagggaccactgcctctcctgctgctgtgctcgagtctgcagagccccacggttgcagtt
aaaatcgactttgacttggcaccagtttcctttgatgatcagtaccaaggctgcagccaa
caggtcttggaggagctgattctggaggattatttcacaaaagaactagcagcccacgag
taccacaaggtctggcaacgtgccctcttagcctggttgaaccaagcaaaagcacccccc
aaggacatggccattgcacatgctgtggccatcttggtttattcatcaaacaacagtgtc
cgctcagatttcatcagagccatggccagtgctgccaggtcttcccagcaatataaaaat
tcattccatttcaaatatctgcactactacctgaccacggcaatccagctgctgaggaaa
gagatggtcaggaggaatgactctttgtgttatgaggtgcaccataaggtagagggtgtt
tacttgagtgccagcacaggtgccaccatacgctttggccaattcctctccacttccctc
ctaagagaagaggcacagaagtttgggaagcaaactctatttaccatattaacctgcctg
ggtgcaccagtacaagacatctctctcaagaaagaggtcctggtccctccctatgagttg
tttgaagtcgtaaatacgagctatcacccaagaggaaattggttgcaattgcggtcaact
gggaacctgagcacgtataattgtcagctgctgaaagcttccagcaaaaagtgcatccct
actcctgcagttattgcttcactctcctttttgaccagtgtcatcatctcttccaaaagt
ggaacataa

DBGET integrated database retrieval system