KEGG   Sus scrofa (pig): 100152910Help
Entry
100152910         CDS       T01009                                 

Gene name
CYP1A2
Definition
cytochrome P450, family 1, subfamily A, polypeptide 2 (EC:1.14.14.1)
Orthology
K07409  
cytochrome P450, family 1, subfamily A, polypeptide 2 [EC:1.14.14.1]
Organism
ssc  Sus scrofa (pig)
Pathway
Steroid hormone biosynthesis
Caffeine metabolism
Tryptophan metabolism
Linoleic acid metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Chemical carcinogenesis
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:ssc00140]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:ssc00591]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:ssc00380]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:ssc00830]
Metabolism; Biosynthesis of other secondary metabolites; Caffeine metabolism [PATH:ssc00232]
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:ssc00980]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:ssc00982]
Human Diseases; Cancers; Chemical carcinogenesis [PATH:ssc05204]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 516 aa AA seqDB search
MTLFQPSLFSATELLLASAIFCLVFWVVRTWQPQVPKGLKSPPGPWGWPLLGHVLTLGKS
PHLALARLSQCYGDVLQIRIGCTPVLVLSGLDTIRQALVRQGDDFKGRPNLYSFTLVTDG
QSMTFNPDSGPVWAARRRLAQKALNTFSIASDPASSSSCYLEDHVSKEAECLLGKFQELM
AGPGHFDPYDHIVVSVGRVIGAMCFGKGFPQSSEEMFSIVKNSHEFVETASSGNPVDFFP
ILRYLPSPTLQRFKSFNQRLLQFLRKMVQERYRDFDKNCIQDITSALFKHSEENSSTSGG
LISQEKTINLVNDIFGAGFDTITTAISWSLLYLVTYPEIQKKIQKELDTVIGRARRPRLS
DRPQLPYMEAFILELFRHTSFVPFTIPHSTTRDTTLNGFYIPKERHVLVNQWQVNHDPKL
WGDPSEFRPERFLTADGTAIHKTMSEKVILFGMGKRRCIGEVLAKWEVFLFLAILLQQLE
FSVPPGVKVDLTPIYGLTMKHAHCKHFQAHLRFPIK
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgacattattccagcccagtctcttctcagccacagagctgctcctggcctctgccatc
ttctgccttgtattctgggtggtcaggacctggcagcctcaggtccccaaaggcctgaag
agtccaccagggccctggggctggcccctgctcgggcacgtgctgaccttgggcaagagc
ccacacctggccctggcaaggctgagccagtgctatggagatgtgctgcaaatccgcatt
ggctgcacccctgtgctggtgctcagcggcctggacaccatccggcaggccctggtgcgg
cagggcgacgatttcaagggacggcccaacctctacagcttcactctggtcactgatggc
cagagcatgaccttcaacccagactctggaccagtgtgggctgcccgtcggcgcctggcc
cagaaggctcttaacaccttctccattgcctcagacccggcttcctcctcctcctgctac
ctggaggatcatgtgagcaaggaggctgagtgcctccttggcaagttccaggagctgatg
gcagggcctgggcactttgatccctatgaccacattgtggtgtcagtgggccgtgtcatc
ggtgccatgtgcttcgggaagggcttcccacagagcagtgaggagatgttcagcatcgtg
aagaacagtcatgaatttgtggagaccgcctcatccgggaaccccgtggacttcttcccc
atccttagatatctgcccagccctactctgcaaagattcaagagtttcaatcaaaggctc
ctgcaattcctgaggaaaatggtccaggagcgctatcgggactttgacaagaactgtatc
caggacatcacaagcgccctattcaagcacagcgaggagaattccagcaccagcggtggc
ctcatctcccaggagaagaccatcaaccttgtcaatgacatttttggagccggatttgat
acaattaccacagccatctcctggagccttttataccttgtgacatatcctgagatacag
aagaagatccagaaggagctggacacagtgattggccgggcgcggcggccccggctctcc
gacagaccccagctgccctatatggaggccttcatcctggagctcttccgacacacctcc
ttcgttcccttcaccatccctcacagcacaacaagggacacgacactgaatggcttctac
atccccaaggaacgccatgtcctcgtaaaccagtggcaggttaatcatgacccgaagctg
tggggggacccatccgagttccggccagagagattcctcactgccgatggcactgccatc
cacaagaccatgagtgagaaagttattctcttcggcatgggcaagcgccggtgcataggg
gaggtcctggccaagtgggaggtcttcctcttcctggccatcttgctgcagcagctagag
ttcagcgtgcctccaggcgtgaaagtggacctaacccccatctacgggctgaccatgaag
catgcccactgcaagcatttccaggcacatctgcgtttccccatcaaatga

DBGET integrated database retrieval system