KEGG   Sus scrofa (pig): 100153403Help
Entry
100153403         CDS       T01009                                 

Gene name
EEA1
Definition
early endosome antigen 1
Orthology
K12478  
early endosome antigen 1
Organism
ssc  Sus scrofa (pig)
Pathway
Endocytosis
Phagosome
Tuberculosis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100153403 (EEA1)
   04145 Phagosome
    100153403 (EEA1)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    100153403 (EEA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
5
AA seq 1410 aa AA seqDB search
MLRRILQRTPGRVGSQGSDLDSSAAPINTVDVNNESSSEGFICPQCMKSLGSADELFKHY
EAVHDAGNDSSQGGEALALKRDDITLLRQEVQDLQASLKEEKWYSEELKKELEKFQGLQQ
QELKPDGVVADSSAELQSLEQQLEEAQTENFNIKQMKDLFEQKAAQLATEIADIKSKYDE
EKSLREAAEQKVTHLTEELNKEATIIQDLKTELLQRPGIEDVAVLKKELVQVQTLMDNMT
LERERESEKLKDECKKLQAEYVNSEATISQLRSELAKGPQEVAVYVQELQKLKSSVNELT
QKNQNLTEKLQKKELDYIQLEEKHNEECVSKKNIQASLHQKDLDCQQLQSRLSASETSLQ
RIQAELGEKGEATQKLKEELSEVETKHQHLKAEFKQLQQQREEKEQHGLQLQSEINQLHS
KLLETERQLGEAHGRLKEQRQLSSEKLMDKEQQVADLQLKLSRLEEELKEKVANSTELQH
QLDKTKQQHQEQQALQQSTTAKLREAQNDLEQVLRQIGDKDQKIQNLEALLQKSKENISL
LEKEREDLYAKIQAGEGETAVLNQLQEKNHILQEQVTQLTEKLKNQSESHKQAQENLHDQ
VQEQKAHLRAAQDRVLSLEASISELSSQLNESKEKVSQLDIQIKAKTELLLSAEAAKTAQ
RADLQNHLDTAQNALQDKQQELNKITTQLDQVTTKLQDKQEHCGQLESHLKEYKEKHLSL
EQKTEELEGQIKKLEADSLEVKASKEQALQDLQQQRQLNTDLELRATELSKQLEMEKETV
SSTKLDLQKKSEALENIKQMLTKQEEEKKILKQEVENLSQNAKMQQKELNNKIQAAVTEL
QKVKMEKETLVTELSAAKEKLSKVSDSLKNSKSEFEKESQKGKAAILDLEKTCKDLKHQL
QVQIESAHKEQNELKNSLEKEKETSHQLKLEINSMQGQLTQAQNSLKQKEKEEQQLQGNI
NELKQLTEQKKKQIEALQGEVKIAVSQKTELENKLQQQSTQAAQELAAEKEKISVLQNAY
EKNQENLKQLQSDFYGKESELLATRQDLKSVEEKLSLAQEDLISNRNQIGNQNKLIQELK
TARTTLEQDSAKKEEQLKEQCKALQDVQKEKSLKEKELVNEKSKLAEIEEIKCRQEKEIA
KLSEELKSHKQESIKEVTNLKDARQLLIQQKLELQGKVDSLKATLEQEKKNQQMLKEQMK
KEEDELKREFMEKETKLHSEIKEKAAAVQKHEENEAKRTMQMTALNENLGTVKKEWQSSQ
RRVSELEKQTDDLRGEIAVLEATVQNNQDERRALLERCLKGEGEIEKLQTKVLELQRKLD
NTTAAVQELGRENQSLQIKHTQALNRKWAEDNEVQNCMACGKGFSVTVRRHHCRQCGNIF
CAECSAKNALTPSSKKPVRVCDSCFNDLQG
NT seq 4233 nt NT seq  +upstreamnt  +downstreamnt
atgttaaggaggattttgcagaggactcctgggagagttggctctcaaggttctgattta
gattcatcagcagctcctataaacacagtggatgtcaataatgaaagctcctcagagggt
ttcatatgtccccagtgtatgaaatctcttggatctgctgatgaacttttcaaacactat
gaggcagttcatgatgctggtaatgattcaagtcagggaggagaagcacttgctctgaaa
cgagatgacataacactactcagacaagaggtccaagacctacaggcttcacttaaggaa
gaaaaatggtactcagaagaattaaagaaagaattagaaaaatttcaaggactgcagcag
caagagttgaaacctgatggagtagtggctgattcatcagcagaactacagtctttggaa
cagcaattagaagaagcccaaacagaaaattttaatattaagcaaatgaaagacttattt
gaacagaaagcagcccaacttgccactgaaattgcagacataaagtcaaagtatgatgaa
gaaaagagtcttcgagaagctgctgaacaaaaagtgacacatctaacagaagaattaaac
aaagaagcaactataattcaagatctaaagactgaactgcttcagagacctggtatagaa
gatgttgctgtgctcaagaaagaactggtccaagtgcaaactctaatggacaacatgacc
ttggaacgtgagagagaatctgaaaaactcaaagatgagtgcaaaaagttacaagcagaa
tatgttaactcagaggccacgataagccagctgaggagtgaacttgccaaaggcccccag
gaagttgctgtgtatgtgcaggaactacaaaaacttaaaagttcagttaatgaattaaca
caaaaaaatcagaacttgactgaaaagttgcagaagaaagaactagactatattcagtta
gaggagaaacataatgaagaatgtgtgagtaagaagaatatacaagcaagccttcaccaa
aaagacctagattgtcaacagcttcagtcaaggttatctgcatctgaaacttcactgcag
agaatacaggcagaattgggtgagaagggagaagctactcaaaagctcaaagaagaatta
tcagaagtggagaccaagcaccagcatcttaaggcagagtttaaacagctacaacaacag
agagaagagaaggagcagcatgggttacaactccaaagtgaaattaatcaattacatagc
aaacttctggagacagagcgccaactaggggaagctcatggtaggctgaaagaacagaga
cagctttcaagtgaaaagttgatggataaagaacaacaagtggctgatctacaactcaaa
ctttctcgtttagaagaagaactgaaggaaaaagtagcaaattccacagaattgcagcat
cagttagataaaacaaagcaacagcatcaagaacaacaagctcttcagcaaagcactaca
gcaaaacttcgagaagctcagaatgatttggaacaagtacttcgtcaaattggtgataag
gaccaaaagatccagaaccttgaagccttattacagaagagtaaagaaaacatttcttta
ttagaaaaggaaagagaagatctttatgcaaaaattcaggctggtgaaggagagactgct
gttcttaatcaattgcaagaaaaaaaccatatattacaggaacaagtaactcaactaacg
gagaaactgaagaatcagtcagaaagccataaacaggcccaggagaatttgcatgaccag
gtgcaagagcagaaggcacatctcagggctgcccaagaccgtgtcctctccctggaagcc
agcatcagtgaattgagcagtcagttaaatgaaagcaaggagaaggtctcccagcttgac
atacagattaaagccaaaactgaattattgctgtcagcagaagcagcaaaaactgctcaa
agagcggatcttcaaaatcatttggacacagctcaaaatgcattacaagataaacagcag
gagttaaataaaatcactactcaactggaccaggtcactacaaagttgcaggataaacaa
gaacattgcggtcagctggaaagtcatcttaaagaatataaagagaaacatctctcttta
gaacagaaaactgaagaattagaaggtcaaattaagaaattggaagctgattcacttgaa
gttaaagcaagcaaggagcaggctttgcaggatctacaacagcaaagacaactgaacacg
gatttagagcttagagctacagaattgagtaaacaacttgaaatggagaaagaaacagta
tccagtacaaagttggatctacagaagaaatccgaagcacttgaaaatattaagcaaatg
cttaccaagcaagaagaagaaaaaaaaatccttaaacaagaagtagaaaatttaagtcaa
aatgcaaaaatgcagcagaaagaattgaataacaaaattcaagcagcagtgacagaacta
caaaaagtgaagatggagaaagaaactctagtaacggagctttctgcagcaaaagagaaa
ttatcaaaagtttctgattctttgaagaactccaaaagtgaatttgaaaaggaaagtcag
aaaggaaaagctgctatattagatctggagaaaacctgcaaagatttaaagcatcaactt
caagtacagatagaaagcgcacataaggaacagaatgaactgaaaaactcacttgaaaaa
gagaaggagacttctcatcagttgaaattggagatcaattcaatgcagggacaactaacg
caggcccagaacagtttaaaacaaaaggaaaaagaagaacaacaacttcagggtaacata
aatgagttaaagcaactgaccgaacagaagaaaaagcaaattgaagcactccaaggagag
gttaaaattgctgtttcacagaagacagaacttgagaataaactacagcagcagtcaaca
caagcagcacaggaacttgcagcagagaaagagaaaatatcagtgttacaaaatgcctat
gaaaaaaatcaggaaaatctaaagcagcttcagtctgatttctatgggaaggaatctgaa
cttcttgccacaaggcaagatctcaagtctgtagaagagaagctttctctagcacaggag
gacttgatttcaaacaggaatcaaattggaaaccaaaataaattgattcaagaactgaag
actgccaggactactttggagcaagattcagccaagaaagaagagcagttgaaggagcag
tgtaaagcactacaagatgttcagaaagaaaagtcactgaaagaaaaagaactagtaaat
gaaaaatctaaattggcagagattgaggaaattaaatgtagacaagaaaaagaaattgct
aaattgagtgaagaactcaagtctcacaagcaagaaagcataaaggaggtaacaaatctc
aaggatgccagacagcttctgattcaacagaaattagagcttcaagggaaagtagattcc
ctgaaggcaacccttgaacaagagaagaaaaaccagcaaatgttaaaagagcagatgaaa
aaggaagaagatgagctgaagagagaatttatggagaaggaaactaaactgcattctgaa
ataaaagaaaaagcagcagcagtgcagaagcatgaggaaaacgaggcgaaacgtaccatg
cagatgaccgcattaaacgaaaacctgggcacggtcaagaaggagtggcagtccagccag
cggcgcgtcagtgagctcgagaagcagacggacgacttacggggagaaatcgcagtgctg
gaagccaccgttcagaataatcaagatgaaagaagggcactactagaaaggtgtcttaaa
ggagaaggtgaaatagaaaagcttcaaaccaaagtactagagttgcaaagaaagctggat
aatacaactgcagcagtgcaggagctgggcagagagaatcagtcccttcagatcaagcat
acacaagcactgaacagaaagtgggccgaagacaatgaagtgcagaactgcatggcctgt
gggaaaggcttctcagtcacagtgcgacggcatcactgcagacaatgtggaaatatcttc
tgtgctgagtgttcagccaaaaatgccttaactccttcttctaagaagcctgttcgtgtc
tgtgattcatgtttcaatgacttgcaaggataa

DBGET integrated database retrieval system