KEGG   Sus scrofa (pig): 100153444Help
Entry
100153444         CDS       T01009                                 

Gene name
UROS
Definition
uroporphyrinogen III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ssc  Sus scrofa (pig)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:ssc00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
14
AA seq 269 aa AA seqDB search
MPAECFTCPASRCAKRRRSCSLRVPYKNGPATMKVLLLKDPKEDDDRGQDPYIRLSHPEG
YGGLIFTSPRAVEAVKLCLEKANKTEAWETSLKEKWNSKSVYVVGNATASLVSKIGLDPE
GENCGNAEKLAEYICSRESSALPLLFPCGNLKRETLPRMLKDKGVPMESITVYQTIPHPG
IQGNLNSYYSQQGIPASITFFSPSGLSYSLKHIQELSGDSIDQIKFVAIGPTTARALAAQ
GLPVSCTAESPTPRALAAGIRTALQPHRC
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgcctgccgagtgcttcacttgcccggcgagtcggtgtgcaaagcgcaggagaagctgc
agcctgagggtgccctataagaacggcccagcaacaatgaaggtccttttactgaaagac
cctaaggaggacgacgaccgcggccaggacccctacatcaggctgtctcatcctgaaggt
tacgggggcctcatttttaccagccccagagcagtggaagcggtgaagctatgtttggag
aaggccaataaaactgaagcctgggaaacgtctctgaaagaaaaatggaattcgaagtca
gtgtatgtggtgggaaatgctactgcttctctagtgagtaaaattggcctggaccctgaa
ggagaaaactgtggaaacgcagaaaagcttgcagaatacatttgttcccgggagtcgtca
gctctgcctcttctctttccctgcggaaacctcaaacgagaaaccctgccacgtatgctc
aaggacaaaggggtccccatggagagcataactgtctaccagacgattccgcaccccggg
atccaggggaacctcaacagctactattcccagcagggcattccagccagcatcacgttt
ttcagcccctctggcctgtcgtacagtctcaagcatattcaggaattatctggtgacagc
attgaccagattaagttcgtggccatcggccccaccacggcccgcgccctggccgcgcag
ggcctgcccgtgagctgcaccgcggagagccccacgccgcgagccctggccgccggcatc
aggacggcgctccagccccacagatgctga

DBGET integrated database retrieval system