KEGG   Sus scrofa (pig): 100153636Help
Entry
100153636         CDS       T01009                                 

Gene name
PPOX
Definition
(RefSeq) protoporphyrinogen oxidase isoform X1
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00860  Porphyrin and chlorophyll metabolism
ssc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    100153636 (PPOX)
Enzymes [BR:ssc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     100153636 (PPOX)
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     100153636 (PPOX)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Thi4 Pyr_redox_2 FAD_oxidored FAD_binding_2
Motif
Other DBs
NCBI-GeneID: 100153636
NCBI-ProteinID: XP_003481464
Ensembl: ENSSSCG00000006361
Position
4
AA seq 477 aa AA seqDB search
MGRTVVVLGGGISGLAASYHLSRAPCPPKVVLVEGSERLGGWIRSIRGPDGAVFELGPRG
IRPAGALGARTLLMVSELGLDSEVLPVRGDHPASKNRFLYVDGALHPLPSGFRGLFCRSP
PFSKPLFWAGLRELTTPRGKDPDESVHSFAQRRLGPEVASLAMDSLCRGVFAGNSRELSI
RSCFPSLFQAEQTHRSVLLGLLMGAGRSPQPDSALIRQARAERWSQWSLRGGLETLPQAL
NAHLTSRGVSVLRGQPVSGLSLQAEGCWKVSLGDSSLEADHIISAVPASVLSKLLPPEAA
PLAHALSTINAVSVAVVNLQYRGARLPVQGFGHLVPSSEDPVILGIVYDSVAFPEQDGSP
SGLRVTVMLGGSWLQTLEARSCVLSQELFQQEAEKAVATQLGLKEPPSHCLVHLHKNCIP
QYTLGHWQKLQSATQYLAAQKLPLTLAGASYEGVAVNDCIESGRQAAAQVLGTESNI
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgggccggaccgtggtcgtgctgggtggaggcatcagcggcctggccgccagttaccat
ctgagccgggccccttgtccccccaaggtggtcttggtggagggcagcgagcgcctaggc
ggctggatccgctcaatacgagggccagatggtgctgtttttgaacttggacctcgagga
attcggcctgctggagccctgggagcccggaccctgctcatggtttctgagcttggtttg
gactcagaagtgttacctgtccggggagaccatccagcttccaagaacaggttcctgtat
gtagatggtgccctgcatcccctgccctctggcttcagggggctattctgccgttcacct
cccttctccaaacctctgttttgggctgggctgagggagttgaccacgcctcggggcaaa
gaccctgatgagagtgtgcacagttttgcccagcgtcgccttggtcctgaggtggcgtct
ctagccatggacagtctctgccgtggagtgtttgcaggcaacagtcgtgagctcagcatc
aggtcctgctttcccagcctcttccaggctgaacaaacccatcgttccgtattactgggg
ctgctgatgggggcaggacggagtccacagccagactcagcacttattcgccaggctcgg
gctgaacgctggagccagtggtcactccgtggaggactggagacattgccccaagccctt
aatgcccacctgactagtaggggtgtcagtgttctcagaggccagccagtctctgggctc
agcctccaggcagaagggtgctggaaggtgtctctaggggacagcagcctggaggctgac
cacattattagtgctgttccagcttcagtgctcagcaagctgctccctcctgaggctgca
cctctggctcatgccctgagtaccatcaatgctgtgtctgtggctgtggtgaacctgcag
taccgaggagctcgtctgcctgtccagggatttgggcatttggtgccatcctcagaagac
ccagtcatcctgggaatcgtgtatgactcagttgctttccctgagcaggatggaagccct
tctggcctcagagtgactgttatgctgggaggttcctggttacagacactagaagccaga
agctgtgtcttatcccaggagctgttccaacaggaggcagagaaagcagttgccacacag
ttaggtttaaaggagccaccaagtcactgcttggtccatctacacaagaactgtatcccc
cagtatacattaggccactggcaaaaactgcagtcagctacccaatacctggctgctcag
aagctgcccttgactctggctggagcctcctatgagggggttgctgtcaatgactgtata
gagagtgggcgccaggcagcagcccaggtcctgggcacagagtcgaatatttga

DBGET integrated database retrieval system