KEGG   Sus scrofa (pig): 100153782Help
Entry
100153782         CDS       T01009                                 

Gene name
USP30
Definition
ubiquitin specific peptidase 30
Orthology
K11851  
ubiquitin carboxyl-terminal hydrolase 30 [EC:3.1.2.15]
Organism
ssc  Sus scrofa (pig)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
14
AA seq 517 aa AA seqDB search
MLSSRAEAAMTAADRAIQRFLRTGAAVRYKVMKNWGVIGGIAAALAAGIYVIWGPITERK
KRRKGLVPGLVNLGNTCFMNSLLQGLSACPTFIKWLEEFTTQYTRDQKEPPQHQYLSLTL
LHLLKALSCQEVTDEEVLDASCLLDVLRMYRWQISSFEEQDAHELFHVITSSLEDERDHQ
PRVTHLFDVHSLEQQPEITPRQITCRTRGSPHPMFNHWKSQHPFHGRLTSNMVCKHCEHQ
SPVRFDTFDSLSLSIPAATWGHPLTLDHCLHHFISSESVRDVVCDNCTKIEAKGTLNGEK
VEHQRTTFVKQLKLGKLPQCLCIHLQRLSWSSHGTPLKRHEHVQFSEFLMMDIYKYHLLG
HKPGPRGPEPCRKAGPALEVQDGPAAPKSVRSQPGGPKTQMLMNGACSPPFLPTLPAPVP
FPLPAVPDHSSSAYLFQLMAVVVHHGDMHSGHFVTYRRSPPSAKNPLSTSNQWLWISDDT
VRKASLQEVLSSSAYLLFYERVLSKMQHQNREYKSEE
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgctgagctcccgggccgaggcggcgatgaccgcggcggacagggccatccagcgcttc
ctgcggaccggggcggcggtcagatacaaagtcatgaagaactggggtgttataggtgga
attgctgctgccctggcagcaggaatatatgttatttggggccccattacggagagaaag
aagaggagaaaagggcttgtgcctggccttgtcaacttggggaacacctgcttcatgaac
tctctgctgcaaggcttgtcagcctgccccactttcatcaagtggctggaagaattcacc
acccagtacaccagggatcagaaggagcccccccagcaccagtacttatccttgaccctg
ttgcacctcctgaaagctttatcctgccaggaagtcactgacgaggaggtcttggatgca
agctgcttgttggacgtcttaagaatgtacagatggcagatctcgtcgtttgaagaacag
gatgctcatgagttgttccacgtcatcacctcgtccctggaggatgagcgggaccaccag
ccccgggtcactcatttgtttgacgtgcactccctggagcaacagccagaaattactccc
agacagataacctgccgcaccagagggtcacctcatcccatgttcaatcactggaagtct
cagcatccttttcatggaagacttacgagtaacatggtctgcaaacactgtgagcaccag
agccctgttcgatttgatacctttgatagcctttcactaagtattccagctgccacatgg
ggtcatccactgaccctggaccactgccttcaccacttcatctcgtcggaatcagtgcga
gatgtcgtatgtgacaactgtacgaagattgaagcaaaagggacgctgaatggggagaag
gtggaacatcagaggaccacgtttgtcaaacagctgaaactagggaagctcccccagtgc
ctgtgcatccacctccagcggctgagctggtctagccacggcacgcccctgaagcggcac
gagcatgtgcagttcagtgagttcctgatgatggatatctacaaatatcacctccttgga
cacaagccggggccccggggccccgagccctgcaggaaggcagggcccgcattggaagtg
caggacgggccggcagcccctaagtcagttcggagccagccggggggccccaaaacacag
atgctcatgaatggcgcctgttccccacccttcctgcccaccctgccagccccggtgccc
ttcccactcccagctgttcctgaccacagctcctccgcgtacctcttccagctgatggct
gttgttgttcaccatggagacatgcattctggacactttgtgacttaccgacggtcccct
ccttcagccaagaaccctctctccaccagcaaccagtggctgtggatttctgatgacact
gtccgcaaggccagcctgcaggaggtcctgtcctccagtgcctacctgctgttttacgag
cgcgtcctttccaagatgcagcaccagaatcgggagtacaagtctgaagaatga

DBGET integrated database retrieval system