KEGG   Sus scrofa (pig): 100153782Help
Entry
100153782         CDS       T01009                                 

Gene name
USP30
Definition
(RefSeq) LOW QUALITY PROTEIN: ubiquitin carboxyl-terminal hydrolase 30
  KO
K11851  
ubiquitin carboxyl-terminal hydrolase 30 [EC:3.4.19.12]
Organism
ssc  Sus scrofa (pig)
Pathway
Mitophagy - animal
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Cellular Processes
  Transport and catabolism
   04137 Mitophagy - animal
    100153782 (USP30)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100153782 (USP30)
Peptidases [BR:ssc01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100153782 (USP30)
Membrane trafficking [BR:ssc04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    100153782 (USP30)
Ubiquitin system [BR:ssc04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100153782 (USP30)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
Position
14
AA seq 517 aa AA seqDB search
MLSSRAEAAMTAADRAIQRFLRTGAAVRYKVMKNWGVIGGIAAALAAGIYVIWGPITERK
KRRKGLVPGLVNLGNTCFMNSLLQGLSACPTFIKWLEEFTTQYTRDQKEPPQHQYLSLTL
LHLLKALSCQEVTDEEVLDASCLLDVLRMYRWQISSFEEQDAHELFHVITSSLEDERDHQ
PRVTHLFDVHSLEQQPEITPRQITCRTRGSPHPMFNHWKSQHPFHGRLTSNMVCKHCEHQ
SPVRFDTFDSLSLSIPAATWGHPLTLDHCLHHFISSESVRDVVCDNCTKIEAKGTLNGEK
VEHQRTTFVKQLKLGKLPQCLCIHLQRLSWSSHGTPLKRHEHVQFSEFLMMDIYKYHLLG
HKPGPRGPSXCRKAGPALEVQDGPAAPKSVRSQPGGPKTQMLMNGACSPPFLPTLPAPVP
FPLPAVPDHSSSAYLFQLMAVVVHHGDMHSGHFVTYRRSPPSAKNPLSTSNQWLWISDDT
VRKASLQEVLSSSAYLLFYERVLSKMQHQNREYKSEE
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgctgagctcccgggccgaggcggcgatgaccgcggcggacagggccatccagcgcttc
ctgcggaccggggcggcggtcagatacaaagtcatgaagaactggggtgttataggtgga
attgctgctgccctggcagcaggaatatatgttatttggggccccattacggagagaaag
aagaggagaaaagggcttgtgcctggccttgtcaacttggggaacacctgcttcatgaac
tctctgctgcaaggcttgtcagcctgccccactttcatcaagtggctggaagaattcacc
acccagtacaccagggatcagaaggagcccccccagcaccagtacttatccttgaccctg
ttgcacctcctgaaagctttatcctgccaggaagtcactgacgaggaggtcttggatgca
agctgcttgttggacgtcttaagaatgtacagatggcagatctcgtcgtttgaagaacag
gatgctcacgagttgttccacgtcatcacctcgtccctggaggatgagcgggaccaccag
ccccgggtcactcatttgtttgacgtgcactccctggagcaacagccagaaattactccc
agacagataacctgccgcaccagagggtcacctcatcccatgttcaatcactggaagtct
cagcatccttttcatggaagacttacgagtaacatggtctgcaaacactgtgagcaccag
agccctgttcgatttgatacctttgatagcctttcactaagtattccagctgccacatgg
ggtcatccactgaccctggaccactgccttcaccacttcatctcgtcggaatcagtgcga
gatgtcgtatgtgacaactgtacgaagattgaagcaaaagggacgctgaatggggagaag
gtggaacatcagaggaccacgtttgtcaaacagctgaaactagggaagctcccccagtgc
ctgtgcatccacctccagcggctgagctggtctagccacggcacgcccctgaagcggcac
gagcatgtgcagttcagtgagttcctgatgatggatatctacaaatatcacctccttgga
cacaagccggggccccggggcccgagcncctgcaggaaggcagggcccgcattggaagtg
caggacgggccggcagcccctaagtcagttcggagccagccggggggccccaaaacacag
atgctcatgaatggcgcctgttccccaccgttcctgcccaccctgccagccccggtgccc
ttcccactcccagctgttcctgaccacagctcctccgcgtacctcttccagctgatggct
gttgttgttcaccatggagacatgcattctggacactttgtgacttaccgacggtcccct
ccttcagccaagaaccctctctccaccagcaaccagtggctgtggatttctgatgacact
gtccgcaaggccagcctgcaggaggtcctgtcctccagtgcctacctgctgttttacgag
cgcgtcctttccaagatgcagcaccagaatcgggagtacaagtctgaagaatga

DBGET integrated database retrieval system