KEGG   Sus scrofa (pig): 100153858Help
Entry
100153858         CDS       T01009                                 

Gene name
PDK3
Definition
pyruvate dehydrogenase kinase, isozyme 3
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
ssc  Sus scrofa (pig)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
X
AA seq 415 aa AA seqDB search
MRLFRWLLKQPVPKQIERYSRFSPSPLSIKQFLDFGRDNACEKTSYMFLRKELPVRLANT
MREVNLLPDNLLNRPSVGLVQSWYMQSFLELLEYENKSPEDPQVLDNFLQVLIKVRNRHN
DVVPTMAQGVIEYKEKFGFDPFISSNIQYFLDRFYTNRISFRMLINQHTLLFGGDTNPAH
PKHIGSIDPTCNVADVVKDAYETAKMLCEQYYLVAPELEVEEFNAKAPNKPIQVVYVPSH
LFHMLFELFKNSMRATVELYEDRKEGYPAVKTLVTLGKEDLSIKISDLGGGVPLRKIDRL
FNYMYSTAPRPSLEPTRAAPLAGFGYGLPISRLYARYFQGDLKLYSMEGVGTDAVIYLKA
LSSESFERLPVFNKSAWRHYKTTPEADDWSNPSSEPRDASKYKAKQDKIKTNRTL
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgcggctgttccggtggctgctgaagcagccggtgcccaagcagatcgagcgctactct
cgcttctcgccgtcaccgctgtccatcaagcagttcctggacttcgggagagataatgcg
tgtgagaaaacttcatatatgttcctgcgaaaggagcttcctgtgcgactggctaacaca
atgagagaagttaatcttctgccagataatttgcttaaccgcccttcggtgggattggtt
cagagttggtatatgcagagttttcttgaacttctagaatatgaaaacaagagccctgaa
gatccacaggtcttagataacttcctacaagttctgattaaagtcagaaatagacacaat
gacgtggttcctacaatggcacaaggagtgatcgaatacaaggagaagtttgggtttgat
ccattcattagcagtaacatccagtattttctggatcggttttataccaaccgcatctct
ttccgcatgcttattaaccagcacacacttctctttggcggtgacaccaatcctgcgcat
cctaaacacataggaagtattgatcccacctgcaacgtggccgatgtcgtgaaagatgca
tatgaaaccgccaagatgctttgtgaacagtattatctggtagctccagagctggaagtt
gaagaattcaatgccaaagctccaaacaaacctattcaagtagtttatgtgccctcacat
ctgtttcacatgctatttgagttgttcaagaactcaatgagagcaacagtcgaactatat
gaagatagaaaagagggctacccagcggttaaaacccttgttactctgggtaaagaagac
ttatccattaagataagtgacttaggtggtggggtcccactacgaaaaatagatcgtctt
tttaactacatgtattcaactgctccgagacctagcctggagcctacaagagctgcccct
ctggctggatttggttatggcttgccaatttctcgtctgtatgctagatattttcaagga
gatctaaaactttattccatggaaggtgtgggtactgatgctgtcatttatttgaaggcc
ctttcaagtgaatcatttgagagacttccagtttttaataagtccgcgtggcgccattac
aagaccacacctgaggctgacgactggagcaaccccagcagtgaacccagagacgcttcc
aaatacaaggcgaaacaggacaagatcaagactaacagaactttgtaa

DBGET integrated database retrieval system