KEGG   Sus scrofa (pig): 100153940Help
Entry
100153940         CDS       T01009                                 

Definition
thrombospondin-2-like
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
ssc  Sus scrofa (pig)
Pathway
Phagosome
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Malaria
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100153940
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100153940
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    100153940
  Cell communication
   04510 Focal adhesion
    100153940
 Human Diseases
  Infectious diseases
   05144 Malaria
    100153940
Exosome [BR:ssc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100153940
  Exosomal proteins of colorectal cancer cells
   100153940
  Exosomal proteins of bladder cancer cells
   100153940
Heparan sulfate/heparin binding proteins [BR:ssc00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  100153940
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 1170 aa AA seqDB search
MLWPLLLLASGAWSSARAGDQDEDTAFDLFSVSNINRKTIGAKQFRGPDPSVPAYRFVRF
DYIPPVGAEPLGRIAEAMRRKEGFFLTASLKQDRKSRGTLLALEGPGATRRQFEIVSNGP
ADTLDLTYWVDGAQHVISLEDVGLADAQWKNVTVQVTGETYSLYVGCDLMDSFTLDEPFY
EQLKTEQSRMYVAKGSARESHFRGLLQNVFLVFENSVEDLLSKKGCRQSQGAEANAISEN
TETLHLSPPVSTGHVGLGAEKGREVCEHSCEELGSMIQELSGLHVIVSQLHENLRKVSND
NQFLWELIGGPPKTRNVSACWQDGRFFAENETWVVDSCTKCTCRKFKTVCHQITCPPATC
ADPAFVDGECCPSCFSDGEEGWSPWAEWTECSATCGPGTQQRGRSCDVTSNTCLGPSIQT
RACSLGKCDHRIRQDGGWSHWSPWSSCSVTCGVGNITRIRLCNSPVPQMGGRGCKGSGRE
TRACQGPPCPVDGRWSPWSPWSACTVTCAGGIRERTRVCNSPEPQHGGKDCVGDVKEQQM
CNKRSCPVDGCLSNPCFPGASCSSFPDGSWSCGSCPVGFLGNGTHCEDLDECAVVTDVCF
TTSKAHRCVNTDPGFHCLPCPPRYKGSQPFGVGLEAARTEKQVCEPENPCEDKTHNCHRH
AECVYLGHFSDPMFKCECRTGYAGDGLICGEDSDLDGWPNKNLVCATNATYHCIKDNCPL
LPNSGQEDFDKDGTGDACDDDDDNDGVSDEKDNCQLLFNPRQFDYDKDEVGDRCDNCPYV
HNPAQIDTDSNGEGDACSVDIDGDDVFNERDNCPYVYNTDQRDTDGDGVGDHCDNCPLVH
NPDQTDVDNDLVGDQCDNNEDVDEDGHQNNQDNCPYISNANQADHDHDGKGDACDSDDDN
DGVPDDRDNCRLVANPDQEDSDGDGRGDACKDDFDNDSIPDIDDVCPENNAISETDFRNF
QMVPLDPKGTTQIDPNWVIRHQGKELVQTANSDPGIAVGFDEFGSVDFSGTFYVNTDRDD
DYAGFVFGYQSSSRFYVVMWKQVTQTYWEDQPTRAYGYSGVSLKVVNSTTGTGEHLRNAL
WHTGNTEGQVRTLWHDPKNIGWKDYTAYRWHLTHRPKTGYIRVLVHEGKQVMADSGPIYD
QTYAGGRLGLFVFSQEMVYFSDLKYECRDI
NT seq 3513 nt NT seq  +upstreamnt  +downstreamnt
atgctgtggcctctgctgctgctggcctcgggggcctggtctagcgctcgggctggtgac
caggacgaggacaccgcctttgacctcttcagcgtcagcaacatcaacaggaagaccatc
ggggccaagcagttccggggcccggaccccagcgtgcccgcctaccgcttcgtgcgcttc
gactacatcccgccggtgggcgcggagcctctgggccggatcgccgaggccatgcggcgg
aaggagggcttcttcctgacggccagcctgaagcaggaccgcaagtcgcggggcacgctc
ctggcgctggagggcccgggggccacgcgcaggcagttcgagatcgtctccaacggcccc
gccgacacgctggacctgacctactgggtggacggcgcccagcacgtcatctccctggag
gacgtgggcctggccgacgcccagtggaagaacgtcacggtgcaggtgaccggggagacc
tacagcctgtacgtgggctgcgacctgatggacagcttcacgctggacgagcctttctac
gagcagctgaagaccgagcagagccggatgtacgtggccaagggctccgcccgcgagagc
cacttcaggggtttgctgcagaatgtcttcttagtttttgaaaactccgtggaagatctt
ctaagcaagaagggctgtcggcaaagccagggagccgaagccaacgccatcagtgagaac
acagagacgctccacctgagccccccggtctccacggggcacgtgggcctgggcgcggag
aagggccgggaggtgtgcgagcactcctgcgaggagctgggcagcatgatccaggagctg
tcggggctgcacgtcatcgtgagccagctccacgagaacctgcgcaaagtgtcaaacgac
aaccagtttctctgggagctcattggcgggccccccaagaccaggaacgtgtccgcctgc
tggcaggacggccgcttcttcgccgagaacgagacctgggtggtggacagctgcaccaaa
tgcacctgcaggaagttcaaaactgtttgccaccaaatcacctgcccgccagcgacatgt
gccgacccggccttcgtggacggcgagtgctgcccatcctgcttctcggacggcgaggag
ggctggtccccgtgggcggagtggacggagtgctctgccacctgtgggcccggcacccag
cagagggggcggtcctgcgacgtgaccagcaacacctgcctggggccgtccatccagacg
cgggcgtgcagcctgggcaagtgcgaccaccgcatccggcaggacggcggctggagccac
tggtctccttggtcctcctgctccgtgacctgcggggtcggcaacatcacgcgcatccgt
ctctgcaactcgccggtgccgcagatgggcgggcggggctgcaaggggagcggccgcgag
accagggcctgccagggcccaccctgccccgtggatggtcggtggagcccctggtccccg
tggtcggcctgcacggtcacctgtgccggcggcatccgggagcggacgcgtgtctgcaac
agcccggagccgcagcacggtggcaaggactgcgtgggggacgtgaaggagcagcagatg
tgcaacaagaggagctgcccagtagacggctgtttgtccaacccctgcttccccggggcc
tcgtgcagcagtttccccgacgggtcctggtcctgcggctcctgccccgtgggcttcctg
ggcaacggcacccactgcgaggacctggacgagtgcgccgtggtcacggacgtgtgcttc
acgaccagcaaggcgcaccgctgcgtcaacaccgaccccggcttccactgcctgccctgc
cccccgcgctacaaggggagccagcccttcggcgtcggcctggaggcggccaggaccgag
aagcaggtgtgtgagcctgaaaacccctgcgaggacaagacccacaactgccacaggcat
gctgagtgtgtctacctgggccacttcagcgaccccatgttcaagtgcgagtgccggacg
ggctacgcgggtgacgggctcatctgtggggaagattcggacctggacggctggcccaac
aagaacctggtctgcgccaccaacgccacctaccactgcatcaaggacaactgcccgctc
ctgcctaactctgggcaagaggactttgacaaggacggcactggggacgcctgtgacgac
gacgacgacaacgacggcgtcagtgatgagaaggacaactgccagcttctcttcaacccc
cgtcagtttgactacgacaaagacgaggttggggaccgctgcgacaactgcccctacgtg
cacaaccccgcacagatcgacaccgacagcaacggggagggcgatgcctgctccgtggac
atcgacggcgacgatgtcttcaacgagcgagacaactgtccctacgtctacaacaccgac
cagagagacacggacggcgacggcgtgggcgaccactgcgacaactgccccctggtgcac
aatcccgaccagacggacgtggacaacgacctcgtgggagaccagtgtgacaacaatgag
gacgtcgacgaggacggccaccagaacaaccaggacaactgtccctacatctccaacgcc
aaccaggccgaccacgaccacgacggcaagggcgacgcctgcgactcggatgacgacaac
gatggggtcccggatgacagggacaactgccggctagtcgccaaccccgaccaggaggac
tcggacggtgatgggcgtggcgacgcttgtaaagacgactttgacaacgacagcatcccg
gacattgacgacgtgtgtcccgagaacaacgccatcagcgagacggacttccgcaacttc
cagatggtgcccctggaccccaagggcaccacgcagatcgatcccaactgggtcattcgc
caccaaggcaaggagctggtgcagacggccaactccgaccccggcatcgctgtgggtttt
gacgagtttgggtccgtggacttcagcggcaccttctacgtcaacacggaccgggacgac
gactacgccggcttcgtctttggctaccagtccagcagccgcttctacgtggtgatgtgg
aagcaggtgacgcagacctactgggaggaccagcccacgcgggcctacggctactccggg
gtgtcgctcaaggtggtaaactccaccacgggcaccggcgagcacctgcgcaacgccctg
tggcacacagggaacacggaggggcaggttcgtaccctgtggcacgaccccaaaaatatt
ggctggaaggactacactgcctaccggtggcacctgacccacaggcctaagacgggctac
ataagagtcttagtgcacgagggaaaacaggtgatggccgattcgggacccatctacgac
cagacctacgcgggcgggcgcctgggcctgttcgtcttctctcaagaaatggtctacttc
tcggacctcaaatacgaatgcagagatatctaa

DBGET integrated database retrieval system