KEGG   Sus scrofa (pig): 100153940Help
Entry
100153940         CDS       T01009                                 

Gene name
THBS2
Definition
(RefSeq) thrombospondin-2 isoform X1
  KO
K04659  
thrombospondin 2/3/4/5
Organism
ssc  Sus scrofa (pig)
Pathway
Phagosome
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Malaria
Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100153940 (THBS2)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100153940 (THBS2)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    100153940 (THBS2)
  Cellular community - eukaryotes
   04510 Focal adhesion
    100153940 (THBS2)
 Human Diseases
  Infectious diseases
   05165 Human papillomavirus infection
    100153940 (THBS2)
   05144 Malaria
    100153940 (THBS2)
Membrane trafficking [BR:ssc04131]
 Endocytosis
  Phagocytosis
   Opsonins
    100153940 (THBS2)
Exosome [BR:ssc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100153940 (THBS2)
  Exosomal proteins of colorectal cancer cells
   100153940 (THBS2)
  Exosomal proteins of bladder cancer cells
   100153940 (THBS2)
Cell adhesion molecules and their ligands [BR:ssc04516]
 2. Integrin Family
  Beta1 integrins
   VLA-3
    ITGB1; integrin beta 1 [KO:K05719]
     100153940 (THBS2)
  Beta3 integrins
   alpha IIb  beta 3
    ITGB3; integrin beta 3 [KO:K06493]
     100153940 (THBS2)
   VNR
     100153940 (THBS2)
 7. Others
  SDC4; syndecan 4 [KO:K16338]
   100153940 (THBS2)
Glycosaminoglycan binding proteins [BR:ssc00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
   100153940 (THBS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
1
AA seq 1188 aa AA seqDB search
MGRRQGGSFAGFSLEGSRMLWPLLLLASGAWSSARAGDQDEDTAFDLFSVSNINRKTIGA
KQFRGPDPSVPAYRFVRFDYIPPVGAEPLGRIAEAMRRKEGFFLTASLKQDRKSRGTLLA
LEGPGATRRQFEIVSNGPADTLDLTYWVDGAQHVISLEDVGLADAQWKNVTVQVTGETYS
LYVGCDLMDSFTLDEPFYEQLKTEQSRMYVAKGSARESHFRGLLQNVFLVFENSVEDLLS
KKGCRQSQGAEANAISENTETLHLSPPVSTGHVGLGAEKGREVCEHSCEELGSMIQELSG
LHVIVSQLHENLRKVSNDNQFLWELIGGPPKTRNVSACWQDGRFFAENETWVVDSCTKCT
CRKFKTVCHQITCPPATCADPAFVDGECCPSCFSDGEEGWSPWAEWTECSATCGPGTQQR
GRSCDVTSNTCLGPSIQTRACSLGKCDHRIRQDGGWSHWSPWSSCSVTCGVGNITRIRLC
NSPVPQMGGRGCKGSGRETRACQGPPCPVDGRWSPWSPWSACTVTCAGGIRERTRVCNSP
EPQHGGKDCVGDVKEQQMCNKRSCPVDGCLSNPCFPGASCSSFPDGSWSCGSCPVGFLGN
GTHCEDLDECAVVTDVCFTTSKAHRCVNTDPGFHCLPCPPRYKGSQPFGVGLEAARTEKQ
VCEPENPCEDKTHNCHRHAECVYLGHFSDPMFKCECRTGYAGDGLICGEDSDLDGWPNKN
LVCATNATYHCIKDNCPLLPNSGQEDFDKDGTGDACDDDDDNDGVSDEKDNCQLLFNPRQ
FDYDKDEVGDRCDNCPYVHNPAQIDTDSNGEGDACSVDIDGDDVFNERDNCPYVYNTDQR
DTDGDGVGDHCDNCPLVHNPDQTDVDNDLVGDQCDNNEDVDEDGHQNNQDNCPYISNANQ
ADHDHDGKGDACDSDDDNDGVPDDRDNCRLVANPDQEDSDGDGRGDACKDDFDNDSIPDI
DDVCPENNAISETDFRNFQMVPLDPKGTTQIDPNWVIRHQGKELVQTANSDPGIAVGFDE
FGSVDFSGTFYVNTDRDDDYAGFVFGYQSSSRFYVVMWKQVTQTYWEDQPTRAYGYSGVS
LKVVNSTTGTGEHLRNALWHTGNTEGQVRTLWHDPKNIGWKDYTAYRWHLTHRPKTGYIR
VLVHEGKQVMADSGPIYDQTYAGGRLGLFVFSQEMVYFSDLKYECRDI
NT seq 3567 nt NT seq  +upstreamnt  +downstreamnt
atggggagaaggcagggcggaagcttcgcagggttttcactggagggaagcaggatgctg
tggcctctgctgctgctggcctcgggggcctggtctagcgctcgggctggtgaccaggac
gaggacaccgcctttgacctcttcagcgtcagcaacatcaacaggaagaccatcggggcc
aagcagttccggggcccggaccccagcgtgcccgcctaccgcttcgtgcgcttcgactac
atcccgccggtgggcgcggagcctctgggccggatcgccgaggccatgcggcggaaggag
ggcttcttcctgacggccagcctgaagcaggaccgcaagtcgcggggcacgctcctggcg
ctggagggcccgggggccacgcgcaggcagttcgagatcgtctccaacggccccgccgac
acgctggacctgacctactgggtggacggcgcccagcacgtcatctccctggaggacgtg
ggcctggccgacgcccagtggaagaacgtcacggtgcaggtgaccggggagacctacagc
ctgtacgtgggctgcgacctgatggacagcttcacgctggacgagcctttctacgagcag
ctgaagaccgagcagagccggatgtacgtggccaagggctccgcccgcgagagccacttc
aggggtttgctgcagaatgtcttcttagtttttgaaaactccgtggaagatcttctaagc
aagaagggctgtcggcaaagccagggagccgaagccaacgccatcagtgagaacacagag
acgctccacctgagccccccggtctccacggggcacgtgggcctgggcgcggagaagggc
cgggaggtgtgcgagcactcctgcgaggagctgggcagcatgatccaggagctgtcgggg
ctgcacgtcatcgtgagccagctccacgagaacctgcgcaaagtgtcaaacgacaaccag
tttctctgggagctcattggcgggccccccaagaccaggaacgtgtccgcctgctggcag
gacggccgcttcttcgccgagaacgagacctgggtggtggacagctgcaccaaatgcacc
tgcaggaagttcaaaactgtttgccaccaaatcacctgcccgccagcgacatgtgccgac
ccggccttcgtggacggcgagtgctgcccatcctgcttctcggacggcgaggagggctgg
tccccgtgggcggagtggacggagtgctctgccacctgtgggcccggcacccagcagagg
gggcggtcctgcgacgtgaccagcaacacctgcctggggccgtccatccagacgcgggcg
tgcagcctgggcaagtgcgaccaccgcatccggcaggacggcggctggagccactggtct
ccttggtcctcctgctccgtgacctgcggggtcggcaacatcacgcgcatccgtctctgc
aactcgccggtgccgcagatgggcgggcggggctgcaaggggagcggccgcgagaccagg
gcctgccagggcccaccctgccccgtggatggtcggtggagcccctggtccccgtggtcg
gcctgcacggtcacctgtgccggcggcatccgggagcggacgcgtgtctgcaacagcccg
gagccgcagcacggtggcaaggactgcgtgggggacgtgaaggagcagcagatgtgcaac
aagaggagctgcccagtagacggctgtttgtccaacccctgcttccccggggcctcgtgc
agcagtttccccgacgggtcctggtcctgcggctcctgccccgtgggcttcctgggcaac
ggcacccactgcgaggacctggacgagtgcgccgtggtcacggacgtgtgcttcacgacc
agcaaggcgcaccgctgcgtcaacaccgaccccggcttccactgcctgccctgccccccg
cgctacaaggggagccagcccttcggcgtcggcctggaggcggccaggaccgagaagcag
gtgtgtgagcctgaaaacccctgcgaggacaagacccacaactgccacaggcatgctgag
tgtgtctacctgggccacttcagcgaccccatgttcaagtgcgagtgccggacgggctac
gcgggtgacgggctcatctgtggggaagattcggacctggacggctggcccaacaagaac
ctggtctgcgccaccaacgccacctaccactgcatcaaggacaactgcccgctcctgcct
aactctgggcaagaggactttgacaaggacggcactggggacgcctgtgacgacgacgac
gacaacgacggcgtcagtgatgagaaggacaactgccagcttctcttcaacccccgtcag
tttgactacgacaaagacgaggttggggaccgctgcgacaactgcccctacgtgcacaac
cccgcacagatcgacaccgacagcaacggggagggcgatgcctgctccgtggacatcgac
ggcgacgatgtcttcaacgagcgagacaactgtccctacgtctacaacaccgaccagaga
gacacggacggcgacggcgtgggcgaccactgcgacaactgccccctggtgcacaatccc
gaccagacggacgtggacaacgacctcgtgggagaccagtgtgacaacaatgaggacgtc
gacgaggacggccaccagaacaaccaggacaactgtccctacatctccaacgccaaccag
gccgaccacgaccacgacggcaagggcgacgcctgcgactcggatgacgacaacgatggg
gtcccggatgacagggacaactgccggctagtcgccaaccccgaccaggaggactcggac
ggtgatgggcgtggcgacgcttgtaaagacgactttgacaacgacagcatcccggacatt
gacgacgtgtgtcccgagaacaacgccatcagcgagacggacttccgcaacttccagatg
gtgcccctggaccccaagggcaccacgcagatcgatcccaactgggtcattcgccaccaa
ggcaaggagctggtgcagacggccaactccgaccccggcatcgctgtgggttttgacgag
tttgggtccgtggacttcagcggcaccttctacgtcaacacggaccgggacgacgactac
gccggcttcgtctttggctaccagtccagcagccgcttctacgtggtgatgtggaagcag
gtgacgcagacctactgggaggaccagcccacgcgggcctacggctactccggggtgtcg
ctcaaggtggtaaactccaccacgggcaccggcgagcacctgcgcaacgccctgtggcac
acagggaacacggaggggcaggttcgtaccctgtggcacgaccccaaaaatattggctgg
aaggactacactgcctaccggtggcacctgacccacaggcctaagacgggctacataaga
gtcttagtgcacgagggaaaacaggtgatggccgattcgggacccatctacgaccagacc
tacgcgggcgggcgcctgggcctgttcgtcttctctcaagaaatggtctacttctcggac
ctcaaatacgaatgcagagatatctaa

DBGET integrated database retrieval system